6G5I - chain z | Serine/threonine-protein kinase RIO1
This structure contains errors and will be reprocessed by KLIFS.
Structure information
| PDB: | 6G5I |
| PubMed: | 29875412 |
| Release date: | 2018-06-06 |
| Resolution: | NMR |
| Kinase: | RIOK1 |
| Family: | RIO |
| Group: | Atypical |
| Species: | HUMAN |
| Quality Score: | 0 |
| Missing Residues: | 70 |
| Missing Atoms: | 0 |
| DFG conformation: | na |
| αC-helix conformation: | na |
| Salt bridge KIII.17 and EαC.24: | NA |
| ASP rotation (xDFG.81) : | ° |
| PHE rotation (xDFG.82) : | 180° |
| Activation loop position: | 0Å |
| αC-helix position: | 0Å |
| G-rich loop angle: | - |
| G-rich loop distance: | - |
| G-rich loop rotation: | - |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | GCISTGKEANVYHRAIKIYWAEKEMRNLIRLNIPCPEPIMLVLVMSFIGAPLLKNVQLSMYQDARLVHADLSEFNMLYIIDVSQS |
| Structure: | ____________________AQREKR___K_NIP_________V_________KRKE____________________________ |
Modified residues
No modified residues identified.