6CZ2 - chain A (model B) | Protein tyrosine kinase 6
Structure information
PDB: | 6CZ2 |
PubMed: | 29879184 |
Release date: | 2018-06-27 |
Resolution: | 2.5 Å |
Kinase: | PTK6 (BRK) |
Family: | Src |
Group: | TK |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (12.7Å) |
ASP rotation (xDFG.81) : | 321° |
PHE rotation (xDFG.82) : | 321° |
Activation loop position: | -4.8Å |
αC-helix position: | 21.3Å |
G-rich loop angle: | 50.3° |
G-rich loop distance: | 14.6Å |
G-rich loop rotation: | 66.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I4
No H-bonds
Binding pocket sequence
Uniprot | RKLGSGYFGEVFEVAIKVIMLQSEIQAMKKLRKHILALYAVYIITELMAKGSLLELLRDYLESQNYIHRDLAARNILVVGDFGLA |
Structure: | RKLGSGYFGEVFEVAIKVIMLQSEIQAMKKLRKHILALYAVYIITELMAKGSLLELLRDYLESQNYIHRDLAARNILVVGDFGLA |
Modified residues
Residue 342 (not in pocket)
Phosphorylated tyrosine