6BUU - chain A (model B) | V-akt murine thymoma viral oncogene homolog 1
Structure information
PDB: | 6BUU |
PubMed: | 30078705 |
Release date: | 2018-08-22 |
Resolution: | 2.4 Å |
Kinase: | AKT1 |
Family: | Akt |
Group: | AGC |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (3.3Å) |
ASP rotation (xDFG.81) : | 331° |
PHE rotation (xDFG.82) : | 1° |
Activation loop position: | -4.1Å |
αC-helix position: | 17.7Å |
G-rich loop angle: | 61° |
G-rich loop distance: | 18Å |
G-rich loop rotation: | 60.2° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I1
H-bond protein
Binding pocket sequence
Uniprot | KLLGKGTFGKVILYAMKILHTLTENRVLQNSRPFLTALKYSCFVMEYANGGELFFHLSRLHSEKNVVYRDLKLENLMLITDFGLC |
Structure: | KLLGKGTFGKVILYAMKILHTLTENRVLQNSRPFLTALKYSCFVMEYANGGELFFHLSRLHSEKNVVYRDLKLENLMLITDFGLC |
Modified residues
Residue 308 (not in pocket)
Phosphorylated threonine
Residue 473 (not in pocket)
Phosphorylated serine
Residue 477 (not in pocket)
Phosphorylated serine