6DC0 - chain B (model A) | Tribbles pseudokinase 1
Structure information
| PDB: | 6DC0 |
| PubMed: | 30254053 |
| Release date: | 2018-10-10 |
| Resolution: | 2.8 Å |
| Kinase: | TRIB1 (Trb1) |
| Family: | Trbl |
| Group: | CAMK |
| Species: | HUMAN |
| Quality Score: | 6.4 |
| Missing Residues: | 2 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | No |
| ASP rotation (xDFG.81) : | 111° |
| PHE rotation (xDFG.82) : | 22° |
| Activation loop position: | -1.3Å |
| αC-helix position: | 18.9Å |
| G-rich loop angle: | 72.4° |
| G-rich loop distance: | 21.4Å |
| G-rich loop rotation: | 20.7° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | LLLPLAEREHVSRLRCKVFYQDKIRPYIQLPSSNITGIVEVYVFFEKDF-GDMHSYVRSHCHQSAIVLGDLKLRKFVFLRLESLE |
| Structure: | LLLPLA__EHVSRLRCKVFYQDKIRPYIQLPSSNITGIVEVYVFFEKDF_GDMHSYVRSHCHQSAIVLGDLKLRKFVFLRLESLE |
Modified residues
No modified residues identified.