6DC0 - chain B (model B) | Tribbles pseudokinase 1
Structure information
PDB: | 6DC0 |
PubMed: | 30254053 |
Release date: | 2018-10-10 |
Resolution: | 2.8 Å |
Kinase: | TRIB1 (Trb1) |
Family: | Trbl |
Group: | CAMK |
Species: | HUMAN |
Quality Score: | 6.4 |
Missing Residues: | 2 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No |
ASP rotation (xDFG.81) : | 111° |
PHE rotation (xDFG.82) : | 22° |
Activation loop position: | -1.3Å |
αC-helix position: | 18.9Å |
G-rich loop angle: | 72.4° |
G-rich loop distance: | 21.4Å |
G-rich loop rotation: | 20.7° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | LLLPLAEREHVSRLRCKVFYQDKIRPYIQLPSSNITGIVEVYVFFEKDF-GDMHSYVRSHCHQSAIVLGDLKLRKFVFLRLESLE |
Structure: | LLLPLA__EHVSRLRCKVFYQDKIRPYIQLPSSNITGIVEVYVFFEKDF_GDMHSYVRSHCHQSAIVLGDLKLRKFVFLRLESLE |
Modified residues
No modified residues identified.