ABL proto-oncogene 1, non-receptor tyrosine kinase
Kinase structure
Kinase:ABL1
Family:Abl
Group:TK
Species:HUMAN
IUPHAR/BPS ID:1923
PDB:2G1T
sc-PDB:
KIDFamMap:Search
Release date:2006-05-23
PubMed: 16640460
Chain:C
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 2G1T
2G1TChain: A
2G1TChain: B
2G1TChain: D


Structural information
DFG conformation:in
αC-helix conformation:out
G-rich loop angle (distance):50.2° (14.8Å)
G-rich loop rotation:53.1°
Quality Score:8
Resolution:1.8 Å
Missing Residues:0
Missing Atoms:0
Ligand binding mode
Waters
Cluster
I3
I4
I5
I6
I11
Ligand
No
No
No
No
No
Protein
Yes
Yes
Yes
Yes
Yes

Pocket alignment
Uniprot sequence:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS
Sequence structure:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS