6BDL - chain B (model A) | Protein kinase, cGMP-dependent, type I
Structure information
PDB: | 6BDL |
PubMed: | - |
Release date: | 2018-10-24 |
Resolution: | 1.96 Å |
Kinase: | PRKG1 (PKG1) |
Family: | PKG |
Group: | AGC |
Species: | HUMAN |
Quality Score: | 9 |
Missing Residues: | 0 |
Missing Atoms: | 10 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.9Å) |
ASP rotation (xDFG.81) : | 347° |
PHE rotation (xDFG.82) : | 18° |
Activation loop position: | -4Å |
αC-helix position: | 17.3Å |
G-rich loop angle: | 61.1° |
G-rich loop distance: | 18.7Å |
G-rich loop rotation: | 50.5° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I11
H-bond protein
Binding pocket sequence
Uniprot | DTLGVGGFGRVELFAMKILHIRSEKQIMQGAHDFIVRLYRTYMLMEACLGGELWTILRDYLHSKGIIYRDLKPENLILLVDFGFA |
Structure: | DTLGVGGFGRVELFAMKILHIRSEKQIMQGAHDFIVRLYRTYMLMEACLGGELWTILRDYLHSKGIIYRDLKPENLILLVDFGFA |
Modified residues
Residue 517 (not in pocket)
Phosphorylated threonine