ABL proto-oncogene 1, non-receptor tyrosine kinase
Kinase structure
Kinase:ABL1
Family:Abl
Group:TK
Species:HUMAN
IUPHAR/BPS ID:1923
PDB:2HZ4
sc-PDB:
KIDFamMap:Search
Release date:2007-01-16
PubMed: 17164530
Chain:C
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 2HZ4
2HZ4Chain: A
2HZ4Chain: B


Structural information
DFG conformation:in
αC-helix conformation:in
G-rich loop angle (distance):-
G-rich loop rotation:-
Quality Score:6
Resolution:2.8 Å
Missing Residues:5
Missing Atoms:0

Allosteric Ligand
Allosteric ligand:4ST
2D structure of the allostericligand
Pocket alignment
Uniprot sequence:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS
Sequence structure:HKLG_____EVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS