ABL proto-oncogene 1, non-receptor tyrosine kinase
Kinase structure
Kinase:ABL1
Family:Abl
Group:TK
Species:HUMAN
IUPHAR/BPS ID:1923
PDB:2F4J
sc-PDB:
KIDFamMap:Search
Release date:2006-01-24
PubMed: 16424036
Chain:A
Orthosteric ligand:VX6
2D structure of the orthosteric ligand
Click to open a 3D viewer
The orthosteric binding pocket
Structural information
DFG conformation:in
αC-helix conformation:in
G-rich loop angle (distance):57.5° (17.7Å)
G-rich loop rotation:4.8°
Quality Score:8
Resolution:1.91 Å
Missing Residues:0
Missing Atoms:0
Ligand binding mode
PocketsSubpocketsWaters
front
gate
BP-I-B
Cluster
I1
I4
Ligand
Yes
No
Protein
Yes
Yes

Pocket alignment
Uniprot sequence:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS
Sequence structure:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS

Ligand affinity
ChEMBL ID:CHEMBL572878
Bioaffinities: 556 records for 204 kinases
Species Kinase (ChEMBL naming) Median Min Max Type Records
Homo sapiens3-phosphoinositide dependent protein kinase-15.65.65.6pKi1
Homo sapiensActivin receptor type-15.75.75.7pKd2
Homo sapiensActivin receptor type-15.95.95.9pKi1
Homo sapiensAdaptor-associated kinase6.56.56.5pKd2
Homo sapiensALK tyrosine kinase receptor5.55.55.5pKd2
Homo sapiensALK tyrosine kinase receptor5.65.65.6pKi1
Homo sapiensAMP-activated protein kinase, alpha-1 subunit666pKd2
Homo sapiensAMP-activated protein kinase, alpha-1 subunit5.65.65.6pKi1
Homo sapiensAMP-activated protein kinase, alpha-2 subunit6.56.56.5pKd2
Homo sapiensAnkyrin repeat and protein kinase domain-containing protein 15.35.35.3pKd2
Homo sapiensBMP-2-inducible protein kinase7.27.27.2pKd2
Homo sapiensBone morphogenetic protein receptor type-1B666pKd1
Homo sapiensBone morphogenetic protein receptor type-25.25.25.2pKd2
Homo sapiensBR serine/threonine-protein kinase 15.15.15.1pKd1
Homo sapiensBR serine/threonine-protein kinase 15.25.25.2pKi1
Homo sapiensCaM kinase I alpha5.25.25.2pKd1
Homo sapiensCaM kinase I delta5.35.35.3pKd2
Homo sapiensCaM kinase I gamma5.25.25.2pKd1
Homo sapiensCaM-kinase kinase alpha5.35.35.3pKd1
Homo sapiensCasein kinase II alpha6.46.46.4pKd1
Homo sapiensCasein kinase II alpha (prime)6.46.46.4pKd1
Homo sapiensCell division cycle 2-like protein kinase 66.76.76.7pKi1
Homo sapiensc-Jun N-terminal kinase 35.65.65.6pKd2
Homo sapiensc-Jun N-terminal kinase 35.75.75.7pKi1
Homo sapiensCyclin-dependent kinase-like 27.37.37.3pKd1
Homo sapiensCyclin-dependent kinase-like 36.56.56.5pKd1
Homo sapiensCyclin-dependent kinase-like 55.65.65.6pKd1
Homo sapiensDeath-associated protein kinase 3556.7pKd2
Homo sapiensDiscoidin domain-containing receptor 26.66.66.6pIC501
Homo sapiensDiscoidin domain-containing receptor 26.66.66.6pKd3
Homo sapiensDual specificity mitogen-activated protein kinase kinase 15.85.85.8pKd2
Homo sapiensDual specificity mitogen-activated protein kinase kinase 15.95.95.9pKi1
Homo sapiensDual specificity mitogen-activated protein kinase kinase 25.75.75.7pKd2
Homo sapiensDual specificity mitogen-activated protein kinase kinase 25.75.75.7pKi1
Homo sapiensDual specificity mitogen-activated protein kinase kinase 56.66.66.6pKd1
Homo sapiensDual specificity mitogen-activated protein kinase kinase 65.65.65.6pKd2
Homo sapiensDual specificity protein kinase TTK5.15.15.1pKd1
Homo sapiensDual specificity testis-specific protein kinase 15.35.35.3pKd2
Homo sapiensEphrin type-A receptor 1666pKd2
Homo sapiensEphrin type-A receptor 26.16.16.1pKd2
Homo sapiensEphrin type-A receptor 26.26.26.2pKi1
Homo sapiensEphrin type-A receptor 35.85.85.8pKd2
Homo sapiensEphrin type-A receptor 45.45.45.4pKd2
Homo sapiensEphrin type-A receptor 65.35.35.3pKd1
Homo sapiensEphrin type-A receptor 86.36.36.3pKd2
Homo sapiensEphrin type-B receptor 15.75.75.7pKd2
Homo sapiensEphrin type-B receptor 25.35.35.3pKd1
Homo sapiensEphrin type-B receptor 45.85.85.8pKd2
Homo sapiensEpidermal growth factor receptor erbB15.85.85.8pKi1
Homo sapiensEpithelial discoidin domain-containing receptor 17.67.67.6pKd2
Homo sapiensEukaryotic translation initiation factor 2-alpha kinase 45.75.75.7pKd2
Homo sapiensFibroblast growth factor receptor 16.36.36.3pKd2
Homo sapiensFibroblast growth factor receptor 16.16.16.1pKi1
Homo sapiensFibroblast growth factor receptor 26.26.26.2pKd2
Homo sapiensFibroblast growth factor receptor 36.16.16.1pKd4
Homo sapiensFibroblast growth factor receptor 36.26.26.2pKi1
Homo sapiensFibroblast growth factor receptor 45.15.15.1pKd2
Homo sapiensG protein-coupled receptor kinase 46.46.46.4pKd1
Homo sapiensHepatocyte growth factor receptor6.26.26.4pKd4
Homo sapiensInhibitor of nuclear factor kappa B kinase epsilon subunit5.65.65.6pKd2
Homo sapiensInsulin-like growth factor I receptor6.36.36.3pIC501
Homo sapiensInsulin-like growth factor I receptor6.16.16.1pKd2
Homo sapiensInsulin receptor6.26.26.3pKd3
Homo sapiensInsulin receptor666pKi1
Homo sapiensInsulin receptor-related protein6.56.56.6pKd3
Homo sapiensInterleukin-1 receptor-associated kinase 35.35.35.3pKd1
Homo sapiensInterleukin-1 receptor-associated kinase 45.45.45.4pKd1
Homo sapiensInterleukin-1 receptor-associated kinase 45.65.65.6pKi1
Homo sapiensLeucine-rich repeat serine/threonine-protein kinase 26.26.26.2pKi1
Homo sapiensLeukocyte tyrosine kinase receptor5.15.15.1pKd2
Homo sapiensLeukocyte tyrosine kinase receptor6.36.36.3pKi1
Homo sapiensLIM domain kinase 15.65.65.6pKd2
Homo sapiensLIM domain kinase 16.16.16.1pKi1
Homo sapiensLIM domain kinase 25.65.65.6pKd2
Homo sapiensMacrophage colony stimulating factor receptor5.85.85.8pKd2
Homo sapiensMacrophage-stimulating protein receptor5.95.95.9pKd1
Homo sapiensMacrophage-stimulating protein receptor6.16.16.1pKi1
Homo sapiensMAP kinase-activated protein kinase 25.45.45.4pKd1
Homo sapiensMAP kinase signal-integrating kinase 25.35.35.3pKd1
Homo sapiensMAP/microtubule affinity-regulating kinase 25.95.95.9pKd2
Homo sapiensMAP/microtubule affinity-regulating kinase 2666pKi1
Homo sapiensMAP/microtubule affinity-regulating kinase 45.35.35.3pKd2
Homo sapiensMAP/microtubule affinity-regulating kinase 4666pKi1
Homo sapiensMaternal embryonic leucine zipper kinase6.46.46.4pIC501
Homo sapiensMaternal embryonic leucine zipper kinase6.66.66.6pKd2
Homo sapiensMaternal embryonic leucine zipper kinase7.47.47.4pKi1
Homo sapiensMisshapen-like kinase 1666pKd1
Homo sapiensMisshapen-like kinase 15.25.25.2pKi1
Homo sapiensMitogen-activated protein kinase 75.25.25.2pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 105.85.85.8pKd2
Homo sapiensMitogen-activated protein kinase kinase kinase 106.46.46.4pKi1
Homo sapiensMitogen-activated protein kinase kinase kinase 116.26.26.2pKd3
Homo sapiensMitogen-activated protein kinase kinase kinase 136.86.86.8pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 2666pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 35.75.75.7pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 45.65.65.6pKd2
Homo sapiensMitogen-activated protein kinase kinase kinase 75.65.65.6pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 96.46.46.4pKd2
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 17.17.17.1pKd2
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 25.65.65.6pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 36.56.56.5pKd2
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 45.65.65.6pKd2
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 57.17.17.3pKd3
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 56.86.86.8pKi1
Homo sapiensMixed lineage kinase 75.65.65.6pKd2
Homo sapiensMixed lineage kinase 75.15.15.1pKi1
Homo sapiensMuscle, skeletal receptor tyrosine protein kinase6.56.56.5pKd2
Homo sapiensMyosin light chain kinase7.87.87.8pKd1
Homo sapiensmyosin light chain kinase 27.47.47.4pKd2
Homo sapiensMyosin light chain kinase family member 45.75.75.7pKd2
Gallus gallusMyosin light chain kinase, smooth muscle7.87.87.8pKd1
Homo sapiensNerve growth factor receptor Trk-A7.47.47.4pKd3
Homo sapiensNerve growth factor receptor Trk-A6.56.56.5pKi1
Homo sapiensNeurotrophic tyrosine kinase receptor type 26.66.66.6pKd2
Homo sapiensNeurotrophic tyrosine kinase receptor type 26.56.56.5pKi1
Homo sapiensNon-receptor tyrosine-protein kinase TNK17.17.17.1pKd3
Homo sapiensNT-3 growth factor receptor6.76.76.7pKd2
Homo sapiensNT-3 growth factor receptor6.26.26.2pKi1
Homo sapiensNUAK family SNF1-like kinase 16.76.76.7pKd2
Homo sapiensNUAK family SNF1-like kinase 26.36.36.3pKd2
Homo sapiensPhosphatidylinositol-4-phosphate 5-kinase type-1 alpha6.96.96.9pKd2
Homo sapiensPhosphatidylinositol-5-phosphate 4-kinase type-2 beta6.96.96.9pKd2
Homo sapiensPhosphorylase kinase gamma subunit 15.75.75.7pKd2
Homo sapiensPhosphorylase kinase gamma subunit 25.45.45.4pKd1
Homo sapiensPITSLRE serine/threonine-protein kinase CDC2L16.56.56.5pKd2
Homo sapiensPITSLRE serine/threonine-protein kinase CDC2L26.66.66.6pKd2
Homo sapiensPlatelet-derived growth factor receptor alpha5.85.85.8pKd2
Homo sapiensPlatelet-derived growth factor receptor beta6.56.56.5pKd2
Homo sapiensPlatelet-derived growth factor receptor beta6.46.46.4pKi1
Homo sapiensProtein kinase C theta5.35.35.3pKd1
Homo sapiensProtein kinase C zeta5.15.15.1pKi1
Homo sapiensProtein kinase N15.85.85.8pKd2
Homo sapiensProtein kinase N25.35.35.3pKd1
Homo sapiensProtein kinase N25.35.35.3pKi1
Homo sapiensProtein tyrosine kinase 2 beta5.65.65.6pKd2
Homo sapiensProto-oncogene tyrosine-protein kinase MER5.85.85.8pKd2
Homo sapiensProto-oncogene tyrosine-protein kinase ROS6.26.26.2pKd2
Homo sapiensProto-oncogene tyrosine-protein kinase ROS6.86.86.8pKi1
Homo sapiensPutative uncharacterized serine/threonine-protein kinase SgK1106.36.36.3pKd1
Homo sapiensReceptor-interacting serine/threonine-protein kinase 17.77.77.7pKd2
Homo sapiensReceptor-interacting serine/threonine-protein kinase 46.56.56.5pKd1
Homo sapiensReceptor tyrosine-protein kinase erbB-35.25.25.2pKd1
Homo sapiensRibosomal protein S6 kinase 15.55.55.5pKi1
Homo sapiensRibosomal protein S6 kinase alpha 15.15.15.1pKd2
Homo sapiensRibosomal protein S6 kinase alpha 25.75.75.7pKd4
Homo sapiensRibosomal protein S6 kinase alpha 35.25.25.2pKd4
Homo sapiensSerine/threonine-protein kinase 106.96.96.9pKd2
Homo sapiensSerine/threonine-protein kinase 115.95.95.9pKd2
Homo sapiensSerine/threonine-protein kinase 166.26.26.2pKd2
Homo sapiensSerine/threonine-protein kinase 17A5.15.15.1pKd1
Homo sapiensSerine/threonine-protein kinase 27.17.17.1pKd2
Homo sapiensSerine/threonine-protein kinase 26.36.36.3pKi1
Homo sapiensSerine/threonine-protein kinase 245.45.45.4pKd2
Homo sapiensSerine/threonine-protein kinase 255.35.35.3pKd2
Homo sapiensSerine/threonine-protein kinase 38-like5.25.25.2pKd1
Homo sapiensSerine/threonine-protein kinase Aurora-A7.86.59.6pIC5017
Homo sapiensSerine/threonine-protein kinase Aurora-A8.87.89.5pKd9
Homo sapiensSerine/threonine-protein kinase Aurora-A9.28.59.2pKi14
Homo sapiensSerine/threonine-protein kinase Aurora-B7.56.17.8pIC5011
Homo sapiensSerine/threonine-protein kinase Aurora-B8.18.18.2pKd3
Homo sapiensSerine/threonine-protein kinase Aurora-B7.87.88.7pKi13
Homo sapiensSerine/threonine-protein kinase Aurora-C7.27.28.3pIC502
Homo sapiensSerine/threonine-protein kinase Aurora-C8.28.28.2pKd3
Homo sapiensSerine/threonine-protein kinase Aurora-C8.38.38.3pKi10
Homo sapiensSerine/threonine-protein kinase Chk15.15.15.1pKd1
Homo sapiensSerine/threonine-protein kinase c-TAK15.65.65.6pKd2
Homo sapiensSerine/threonine-protein kinase c-TAK15.45.45.4pKi1
Homo sapiensSerine/threonine-protein kinase D25.35.35.3pKi1
Homo sapiensSerine/threonine-protein kinase DCLK35.45.45.4pKd2
Homo sapiensSerine/threonine-protein kinase GAK5.55.55.5pKd2
Homo sapiensSerine/threonine-protein kinase LATS15.35.35.3pKd2
Homo sapiensSerine/threonine-protein kinase LATS25.25.25.2pKd1
Homo sapiensSerine/threonine-protein kinase MARK15.35.35.3pKd2
Homo sapiensSerine/threonine-protein kinase MST16.76.76.7pKd2
Homo sapiensSerine/threonine-protein kinase MST26.36.36.3pKd2
Homo sapiensSerine/threonine-protein kinase MST45.55.55.5pKd1
Homo sapiensSerine/threonine-protein kinase Nek55.45.45.4pKd2
Homo sapiensSerine/threonine-protein kinase NEK75.15.15.1pKd1
Homo sapiensSerine/threonine-protein kinase PAK 15.45.45.4pKd2
Homo sapiensSerine/threonine-protein kinase PAK 15.15.15.1pKi1
Homo sapiensSerine/threonine-protein kinase PAK 25.25.25.2pKd2
Homo sapiensSerine/threonine-protein kinase PAK 35.55.55.5pKd2
Homo sapiensSerine/threonine-protein kinase PAK 45.45.45.4pKd2
Homo sapiensSerine/threonine-protein kinase PAK 45.45.45.4pKi1
Homo sapiensSerine/threonine-protein kinase PAK6555pKd1
Homo sapiensSerine/threonine-protein kinase PAK75.55.55.5pKd2
Homo sapiensSerine/threonine-protein kinase PCTAIRE-16.66.66.6pKd2
Homo sapiensSerine/threonine-protein kinase PCTAIRE-25.35.35.3pKd1
Homo sapiensSerine/threonine-protein kinase PLK4888.1pKd3
Homo sapiensSerine/threonine-protein kinase PLK487.68pKi3
Homo sapiensSerine/threonine-protein kinase receptor R3555pKd1
Homo sapiensSerine/threonine-protein kinase RIO16.46.46.4pKd2
Homo sapiensSerine/threonine-protein kinase RIO26.66.66.6pKd1
Homo sapiensSerine/threonine-protein kinase RIO36.26.26.2pKd2
Homo sapiensSerine/threonine-protein kinase SIK15.65.65.6pKd2
Homo sapiensSerine/threonine-protein kinase SIK25.85.85.8pKd2
Homo sapiensSerine/threonine-protein kinase SIK2666pKi1
Homo sapiensSerine/threonine-protein kinase SRPK17.17.17.1pKd2
Homo sapiensSerine/threonine-protein kinase SRPK26.26.26.2pKd2
Homo sapiensSerine/threonine-protein kinase SRPK36.66.66.6pKd1
Homo sapiensSerine/threonine-protein kinase TAO16.56.56.5pKd1
Homo sapiensSerine/threonine-protein kinase TAO17.17.17.1pKi1
Homo sapiensSerine/threonine-protein kinase TAO26.46.46.4pKd1
Homo sapiensSerine/threonine-protein kinase TAO37.17.17.1pKd1
Homo sapiensSerine/threonine-protein kinase TBK16.36.36.3pKd1
Homo sapiensSerine/threonine-protein kinase tousled-like 15.45.45.4pKd1
Homo sapiensSerine/threonine-protein kinase ULK36.56.56.5pKd1
Homo sapiensSerine/threonine-protein kinase WEE15.55.55.5pKd2
Homo sapiensSPS1/STE20-related protein kinase YSK47.37.37.3pKd1
Homo sapiensStem cell growth factor receptor6.55.66.6pKd15
Homo sapiensTGF-beta receptor type I5.15.15.1pKd1
Homo sapiensTRAF2- and NCK-interacting kinase5.85.85.8pKd2
Homo sapiensTyrosine kinase non-receptor protein 25.45.45.4pKd2
Homo sapiensTyrosine-protein kinase ABL85.18.5pKd22
Homo sapiensTyrosine-protein kinase ABL7.57.47.8pKi3
Homo sapiensTyrosine-protein kinase ABL28.48.48.4pKd3
Homo sapiensTyrosine-protein kinase BLK5.75.75.7pKd2
Homo sapiensTyrosine-protein kinase BLK7.57.57.5pKi1
Homo sapiensTyrosine-protein kinase BMX5.65.65.6pKd2
Homo sapiensTyrosine-protein kinase BTK5.45.45.4pKd2
Homo sapiensTyrosine-protein kinase BTK5.85.85.8pKi1
Homo sapiensTyrosine-protein kinase CSK5.35.35.3pKd2
Homo sapiensTyrosine-protein kinase FER5.45.45.4pKd1
Homo sapiensTyrosine-protein kinase FES5.15.15.1pKd1
Homo sapiensTyrosine-protein kinase FGR6.16.16.1pKd2
Homo sapiensTyrosine-protein kinase FRK5.45.45.4pKd2
Homo sapiensTyrosine-protein kinase FYN6.36.36.3pKd2
Homo sapiensTyrosine-protein kinase FYN5.55.55.5pKi1
Homo sapiensTyrosine-protein kinase HCK5.25.25.2pKd1
Homo sapiensTyrosine-protein kinase ITK/TSK6.56.56.5pKd2
Homo sapiensTyrosine-protein kinase ITK/TSK7.27.27.2pKi1
Homo sapiensTyrosine-protein kinase JAK15.25.25.2pKd2
Homo sapiensTyrosine-protein kinase JAK26.76.76.7pKd6
Homo sapiensTyrosine-protein kinase JAK26.66.66.6pKi2
Homo sapiensTyrosine-protein kinase JAK36.26.26.2pKd4
Homo sapiensTyrosine-protein kinase LCK7.27.27.2pKd2
Homo sapiensTyrosine-protein kinase LCK6.96.97.1pKi2
Homo sapiensTyrosine-protein kinase Lyn6.26.26.2pKd2
Homo sapiensTyrosine-protein kinase Lyn6.66.66.6pKi1
Homo sapiensTyrosine-protein kinase receptor FLT37.57.57.5pIC501
Homo sapiensTyrosine-protein kinase receptor FLT37.96.98.4pKd13
Homo sapiensTyrosine-protein kinase receptor FLT37.56.47.5pKi5
Homo sapiensTyrosine-protein kinase receptor RET7.67.68.1pKd7
Homo sapiensTyrosine-protein kinase receptor RET7.97.97.9pKi1
Homo sapiensTyrosine-protein kinase receptor Tie-16.66.66.6pKd2
Homo sapiensTyrosine-protein kinase receptor TYRO35.95.95.9pKi1
Homo sapiensTyrosine-protein kinase receptor UFO6.76.76.7pKd2
Homo sapiensTyrosine-protein kinase receptor UFO6.76.76.7pKi1
Gallus gallusTyrosine-protein kinase SRC6.56.56.5pIC501
Homo sapiensTyrosine-protein kinase SRC6.86.86.8pKd2
Homo sapiensTyrosine-protein kinase SRC6.86.86.8pKi1
Homo sapiensTyrosine-protein kinase SYK5.85.85.8pKd2
Homo sapiensTyrosine-protein kinase TEC5.15.15.1pKd1
Homo sapiensTyrosine-protein kinase TIE-26.46.46.4pKd2
Homo sapiensTyrosine-protein kinase TXK5.65.65.6pKd2
Homo sapiensTyrosine-protein kinase TYK25.25.26.3pKd4
Homo sapiensTyrosine-protein kinase TYK26.76.76.7pKi2
Homo sapiensTyrosine-protein kinase YES6.36.36.3pKd2
Homo sapiensVascular endothelial growth factor receptor 1777pKd2
Homo sapiensVascular endothelial growth factor receptor 15.95.95.9pKi1
Homo sapiensVascular endothelial growth factor receptor 25.75.75.7pKd2
Homo sapiensVascular endothelial growth factor receptor 26.56.56.5pKi1
Homo sapiensVascular endothelial growth factor receptor 35.75.75.7pKd2
Homo sapiensVascular endothelial growth factor receptor 35.85.85.8pKi1
Homo sapiensWee1-like protein kinase 25.45.45.4pKd1


Kinase-ligand interaction pattern
Hydrophobic Aromatic face-to-face Aromatic face-to-edge H-bond donor H-bond acceptor Ionic positive Ionic negative
I g.l II III αC
1 H
246
2 K
247
3 L
248
4 G
249
5 G
250
6 G
251
7 Q
252
8 Y
253
9 G
254
10 E
255
11 V
256
12 Y
257
13 E
258
14 V
268
15 A
269
16 V
270
17 K
271
18 T
272
19 L
273
20 E
282
αC b.l IV
21 F
283
22 L
284
23 K
285
24 E
286
25 A
287
26 A
288
27 V
289
28 M
290
29 K
291
30 E
292
31 I
293
32 K
294
33 P
296
34 N
297
35 L
298
36 V
299
37 Q
300
38 L
301
39 L
302
40 G
303
IV V GK hinge linker αD αE
41 V
304
42 Y
312
43 I
313
44 I
314
45 T
315
46 E
316
47 F
317
48 M
318
49 T
319
50 Y
320
51 G
321
52 N
322
53 L
323
54 L
324
55 D
325
56 Y
326
57 L
327
58 R
328
59 E
329
60 Y
353
αE VI c.l VII VIII x
61 L
354
62 E
355
63 K
356
64 K
357
65 N
358
66 F
359
67 I
360
68 H
361
69 R
362
70 D
363
71 L
364
72 A
365
73 A
366
74 R
367
75 N
368
76 C
369
77 L
370
78 V
371
79 V
379
80 A
380
DFG a.l
81 D
381
82 F
382
83 G
383
84 L
384
85 S
385

Interaction pattern search
Search KLIFS for kinase-ligand complexes with similar interaction patterns:
Specify the minimum similarity (0.00 no similarity, 1.00 identical)