ABL proto-oncogene 1, non-receptor tyrosine kinase
Kinase structure
Kinase:ABL1
Family:Abl
Group:TK
Species:HUMAN
IUPHAR/BPS ID:1923
PDB:2G2F
sc-PDB:
KIDFamMap:Search
Release date:2006-05-23
PubMed: 16640460
Chain:A
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 2G2F
2G2FChain: B


Structural information
DFG conformation:out-like
αC-helix conformation:in
G-rich loop angle (distance):55.7° (16.9Å)
G-rich loop rotation:41.1°
Quality Score:8
Resolution:2.7 Å
Missing Residues:0
Missing Atoms:0

Pocket alignment
Uniprot sequence:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS
Sequence structure:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS