4X7Q - chain A | Pim-2 proto-oncogene, serine/threonine kinase
Structure information
PDB: | 4X7Q |
PubMed: | 25575657 |
Release date: | 2015-02-11 |
Resolution: | 2.33 Å |
Kinase: | PIM2 |
Family: | PIM |
Group: | CAMK |
Species: | HUMAN |
Quality Score: | 7.8 |
Missing Residues: | 3 |
Missing Atoms: | 10 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.6Å) |
ASP rotation (xDFG.81) : | 343° |
PHE rotation (xDFG.82) : | 10° |
Activation loop position: | -3.7Å |
αC-helix position: | 17.6Å |
G-rich loop angle: | 51.9° |
G-rich loop distance: | 16.1Å |
G-rich loop rotation: | 40.9° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I5
H-bond ligand
H-bond protein
Binding pocket sequence
Uniprot | PLLGKGGFGTVFAVAIKVITCPLEVALLWKVGPGVIRLLDWMLVLERPLAQDLFDYITEHCHSRGVVHRDIKDENILILIDFGSG |
Structure: | PLLGKGGFGTVFAVAIKVI___LEVALLWKVGPGVIRLLDWMLVLERPLAQDLFDYITEHCHSRGVVHRDIKDENILILIDFGSG |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: 3YR
Ligand Name: 2-(2,6-difluorophenyl)-N-{4-[(3S)-pyrrolidin-3-yloxy]pyridin-3-yl}-1,3-thiazole-4-carboxamide
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 P 36 | 2 L 37 | 3 L 38 | 4 G 39 | 5 K 40 | 6 G 41 | 7 G 42 | 8 F 43 | 9 G 44 | 10 T 45 | 11 V 46 | 12 F 47 | 13 A 48 | 14 V 58 | 15 A 59 | 16 I 60 | 17 K 61 | 18 V 62 | 19 I 63 | 20 _ _ |
■ | ■ | ■♦ | ■ | ■ | ■ | ||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 _ _ | 22 _ _ | 23 L 82 | 24 E 83 | 25 V 84 | 26 A 85 | 27 L 86 | 28 L 87 | 29 W 88 | 30 K 89 | 31 V 90 | 32 G 91 | 33 P 97 | 34 G 98 | 35 V 99 | 36 I 100 | 37 R 101 | 38 L 102 | 39 L 103 | 40 D 104 |
■ | |||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 W 105 | 42 M 113 | 43 L 114 | 44 V 115 | 45 L 116 | 46 E 117 | 47 R 118 | 48 P 119 | 49 L 120 | 50 A 122 | 51 Q 123 | 52 D 124 | 53 L 125 | 54 F 126 | 55 D 127 | 56 Y 128 | 57 I 129 | 58 T 130 | 59 E 131 | 60 H 153 |
■ | ■ | ■ | ■ | ■ | ■ | ■ | |||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 C 154 | 62 H 155 | 63 S 156 | 64 R 157 | 65 G 158 | 66 V 159 | 67 V 160 | 68 H 161 | 69 R 162 | 70 D 163 | 71 I 164 | 72 K 165 | 73 D 166 | 74 E 167 | 75 N 168 | 76 I 169 | 77 L 170 | 78 I 171 | 79 L 180 | 80 I 181 |
■▲ | ■ | ■ | |||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 182 | 82 F 183 | 83 G 184 | 84 S 185 | 85 G 186 | |||||||||||||||
■ |
Binding affinities
ChEMBL ID:CHEMBL3354511Bioaffinities: 3 records for 3 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Serine/threonine-protein kinase PIM1 | 8.3 | 8.3 | 8.3 | pIC50 | 1 |
Homo sapiens | Serine/threonine-protein kinase PIM2 | 7.9 | 7.9 | 7.9 | pIC50 | 1 |
Homo sapiens | Serine/threonine-protein kinase PIM3 | 8.7 | 8.7 | 8.7 | pIC50 | 1 |