4LG4 - chain B (model B) | Serine/threonine kinase 3
Structure information
PDB: | 4LG4 |
PubMed: | 23972470 |
Release date: | 2013-09-18 |
Resolution: | 2.42 Å |
Kinase: | STK3 (MST2) |
Family: | STE20 |
Group: | STE |
Species: | HUMAN |
Quality Score: | 6 |
Missing Residues: | 5 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No (5.4Å) |
ASP rotation (xDFG.81) : | 4° |
PHE rotation (xDFG.82) : | 353° |
Activation loop position: | -4.2Å |
αC-helix position: | 17.3Å |
G-rich loop angle: | - |
G-rich loop distance: | - |
G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | EKLGEGSYGSVFKVAIKQVEIIKEISIMQQCDPYVVKYYGSWIVMEYCGAGSVSDIIRLYLHFMRKIHRDIKAGNILLLADFGVA |
Structure: | EKLGEGS___VFKVAIKQVEIIKEISIMQQCDPYVVKYYGSWIVMEYCGAGSVSDIIRLYLHFMRKIHRNIKAGNILLLADFG__ |
Modified residues
No modified residues identified.