4LG4 - chain F (model A) | Serine/threonine kinase 3
Structure information
| PDB: | 4LG4 |
| PubMed: | 23972470 |
| Release date: | 2013-09-18 |
| Resolution: | 2.42 Å |
| Kinase: | STK3 (MST2) |
| Family: | STE20 |
| Group: | STE |
| Species: | HUMAN |
| Quality Score: | 6 |
| Missing Residues: | 2 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | No (6.4Å) |
| ASP rotation (xDFG.81) : | 5° |
| PHE rotation (xDFG.82) : | 343° |
| Activation loop position: | -3.9Å |
| αC-helix position: | 18.5Å |
| G-rich loop angle: | 64° |
| G-rich loop distance: | 18Å |
| G-rich loop rotation: | 75.1° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I8
H-bond protein
Binding pocket sequence
| Uniprot | EKLGEGSYGSVFKVAIKQVEIIKEISIMQQCDPYVVKYYGSWIVMEYCGAGSVSDIIRLYLHFMRKIHRDIKAGNILLLADFGVA |
| Structure: | EKLGEGSYGSVFKVAIKQVEIIKEISIMQQCDPYVVKYYGSWIVMEYCGAGSVSDIIRLYLHFMRKIHRNIKAGNILLLADFG__ |
Modified residues
No modified residues identified.