3CIK - chain A | Adrenergic, beta, receptor kinase 1
Structure information
| PDB: | 3CIK |
| PubMed: | 20128603 |
| Release date: | 2009-02-17 |
| Resolution: | 2.75 Å |
| Kinase: | GRK2 (BARK1) |
| Family: | GRK |
| Group: | AGC |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (2.8Å) |
| ASP rotation (xDFG.81) : | 11° |
| PHE rotation (xDFG.82) : | 355° |
| Activation loop position: | -3.6Å |
| αC-helix position: | 18Å |
| G-rich loop angle: | 62.7° |
| G-rich loop distance: | 18.4Å |
| G-rich loop rotation: | 69.5° |
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I5
H-bond protein
Binding pocket sequence
| Uniprot | RIIGRGGFGEVYGYAMKCLLALNERIMLSLVSPFIVCMSYASFILDLMNGGDLHYHLSQHMHNRFVVYRDLKPANILLISDLGLA |
| Structure: | RIIGRGGFGEVYGYAMKCLLALNERIMLSLVSPFIVCMSYASFILDLMNGGDLHYHLSQHMHNRFVVYRDLKPANILLISDLGLA |
Modified residues
No modified residues identified.