3CQE - chain A (model A) | WEE1 G2 checkpoint kinase
Structure information
PDB: | 3CQE |
PubMed: | - |
Release date: | 2009-02-24 |
Resolution: | 2.5 Å |
Kinase: | WEE1 (Wee1) |
Family: | WEE |
Group: | Other |
Species: | HUMAN |
Quality Score: | 8.6 |
Missing Residues: | 0 |
Missing Atoms: | 14 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No (5.6Å) |
ASP rotation (xDFG.81) : | 345° |
PHE rotation (xDFG.82) : | 338° |
Activation loop position: | -3.4Å |
αC-helix position: | 17.4Å |
G-rich loop angle: | 57.9° |
G-rich loop distance: | 17.2Å |
G-rich loop rotation: | 45.9° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I2
H-bond protein
I4
H-bond protein
Binding pocket sequence
Uniprot | EKIGSGEFGSVFKYAIKRSNALREVYAHAVLGSHVVRYFSALIQNEYCNGGSLADAISEYIHSMSLVHMDIKPSNIFIIGDLGHV |
Structure: | EKIGSGEFGSVFKYAIKRSNALREVYAHAVLGSHVVRYFSALIQNEYCNGGSLADAISEYIHSMSLVHMDIKPSNIFIIGDLGHV |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: P91
Ligand Name: 8-bromo-4-(2-chlorophenyl)-N-(2-hydroxyethyl)-6-methyl-1,3-dioxo-1,2,3,6-tetrahydropyrrolo[3,4-e]indole-7-carboxamide
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 E 303 | 2 K 304 | 3 I 305 | 4 G 306 | 5 S 307 | 6 G 308 | 7 E 309 | 8 F 310 | 9 G 311 | 10 S 312 | 11 V 313 | 12 F 314 | 13 K 315 | 14 Y 325 | 15 A 326 | 16 I 327 | 17 K 328 | 18 R 329 | 19 S 330 | 20 N 342 |
■ | ■ | ■ | ■ | ■ | ■ | ||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 A 343 | 22 L 344 | 23 R 345 | 24 E 346 | 25 V 347 | 26 Y 348 | 27 A 349 | 28 H 350 | 29 A 351 | 30 V 352 | 31 L 353 | 32 G 354 | 33 S 357 | 34 H 358 | 35 V 359 | 36 V 360 | 37 R 361 | 38 Y 362 | 39 F 363 | 40 S 364 |
■ | |||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 A 365 | 42 L 373 | 43 I 374 | 44 Q 375 | 45 N 376 | 46 E 377 | 47 Y 378 | 48 C 379 | 49 N 380 | 50 G 381 | 51 G 382 | 52 S 383 | 53 L 384 | 54 A 385 | 55 D 386 | 56 A 387 | 57 I 388 | 58 S 389 | 59 E 390 | 60 Y 416 |
■▲ | ▲ | ■ | ■▲ | ■ | ▲ | ■▲ | |||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 I 417 | 62 H 418 | 63 S 419 | 64 M 420 | 65 S 421 | 66 L 422 | 67 V 423 | 68 H 424 | 69 M 425 | 70 D 426 | 71 I 427 | 72 K 428 | 73 P 429 | 74 S 430 | 75 N 431 | 76 I 432 | 77 F 433 | 78 I 434 | 79 I 461 | 80 G 462 |
■♦♦ | |||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 463 | 82 L 464 | 83 G 465 | 84 H 466 | 85 V 467 | |||||||||||||||
■ |
Binding affinities
Ligand not found in ChEMBL.