1IAS - chain B | Transforming growth factor beta receptor I
Structure information
PDB: | 1IAS |
PubMed: | 11583628 |
Release date: | 2001-10-03 |
Resolution: | 2.9 Å |
Kinase: | TGFBR1 (TGFbR1) |
Family: | STKR |
Group: | TKL |
Species: | HUMAN |
Quality Score: | 7.2 |
Missing Residues: | 2 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.8Å) |
ASP rotation (xDFG.81) : | 350° |
PHE rotation (xDFG.82) : | 353° |
Activation loop position: | -3.3Å |
αC-helix position: | 17.2Å |
G-rich loop angle: | 49.8° |
G-rich loop distance: | 15.4Å |
G-rich loop rotation: | 67.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | ESIGKGRFGEVWRVAVKIFSWFREAEIYQTVMENILGFIAAWLVSDYHEHGSLFDYLNRTQGKPAIAHRDLKSKNILVIADLGLA |
Structure: | ESIGKGRFGEVWRVAVKIFSWFREAEIYQTVMENILGFIAAWLVSDYHEHGSLFDYLNR__GKPAIAHRDLKSKNILVIADLGLA |
Modified residues
No modified residues identified.