1B6C - chain B | Transforming growth factor beta receptor I
Structure information
PDB: | 1B6C |
PubMed: | 10025408 |
Release date: | 1999-06-15 |
Resolution: | 2.6 Å |
Kinase: | TGFBR1 (TGFbR1) |
Family: | STKR |
Group: | TKL |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (4.1Å) |
ASP rotation (xDFG.81) : | 350° |
PHE rotation (xDFG.82) : | 355° |
Activation loop position: | -3.4Å |
αC-helix position: | 16.4Å |
G-rich loop angle: | 52.5° |
G-rich loop distance: | 15.9Å |
G-rich loop rotation: | 53.1° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | ESIGKGRFGEVWRVAVKIFSWFREAEIYQTVMENILGFIAAWLVSDYHEHGSLFDYLNRTQGKPAIAHRDLKSKNILVIADLGLA |
Structure: | ESIGKGRFGEVWRVAVKIFSWFREAEIYQTVMENILGFIAAWLVSDYHEHGSLFDYLNRTQGKPAIAHRDLKSKNILVIADLGLA |
Modified residues
No modified residues identified.