3NDM - chain A | Rho associated coiled-coil containing protein kinase 1
Structure information
| PDB: | 3NDM |
| PubMed: | 20678931 |
| Release date: | 2010-12-08 |
| Resolution: | 3.3 Å |
| Kinase: | ROCK1 |
| Family: | DMPK |
| Group: | AGC |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (3.8Å) |
| ASP rotation (xDFG.81) : | 12° |
| PHE rotation (xDFG.82) : | 3° |
| Activation loop position: | -4.7Å |
| αC-helix position: | 16.3Å |
| G-rich loop angle: | 54.9° |
| G-rich loop distance: | 17.1Å |
| G-rich loop rotation: | 70.9° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | KVIGRGAFGEVQLYAMKLLFFWEERDIMAFANPWVVQLFYAYMVMEYMPGGDLVNLMSNAIHSMGFIHRDVKPDNMLLLADFGTC |
| Structure: | KVIGRGAFGEVQLYAMKLLFFWEERDIMAFANPWVVQLFYAYMVMEYMPGGDLVNLMSNAIHSMGFIHRDVKPDNMLLLADFGTC |
Modified residues
No modified residues identified.