3HDM - chain A | Serum/glucocorticoid regulated kinase 1
Structure information
PDB: | 3HDM |
PubMed: | 19497745 |
Release date: | 2009-06-30 |
Resolution: | 2.6 Å |
Kinase: | SGK1 |
Family: | SGK |
Group: | AGC |
Species: | HUMAN |
Quality Score: | 5.9 |
Missing Residues: | 7 |
Missing Atoms: | 5 |
DFG conformation: | in |
αC-helix conformation: | na |
Salt bridge KIII.17 and EαC.24: | NA |
ASP rotation (xDFG.81) : | 329° |
PHE rotation (xDFG.82) : | 261° |
Activation loop position: | -1.7Å |
αC-helix position: | 0Å |
G-rich loop angle: | 43.7° |
G-rich loop distance: | 13.3Å |
G-rich loop rotation: | 82.5° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | KVIGKGSFGKVLLYAVKVLHIMSERNVLLKNVPFLVGLHFSYFVLDYINGGELFYHLQRYLHSLNIVYRDLKPENILLLTDFGLC |
Structure: | KVIGKGSFGKVLLYAVKVL_______VLLKNVPFLVGLHFSYFVLDYINGGELFYHLQRYLHSLNIVYRDLKPENILLLTDFGLC |
Modified residues
No modified residues identified.
Orthosteric ligand
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 K 102 | 2 V 103 | 3 I 104 | 4 G 105 | 5 K 106 | 6 G 107 | 7 S 108 | 8 F 109 | 9 G 110 | 10 K 111 | 11 V 112 | 12 L 113 | 13 L 114 | 14 Y 124 | 15 A 125 | 16 V 126 | 17 K 127 | 18 V 128 | 19 L 129 | 20 _ _ |
■ | ■ | ■ | ■ | ■● | |||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 _ _ | 22 _ _ | 23 _ _ | 24 _ _ | 25 _ _ | 26 _ _ | 27 V 149 | 28 L 150 | 29 L 151 | 30 K 152 | 31 N 153 | 32 V 154 | 33 P 157 | 34 F 158 | 35 L 159 | 36 V 160 | 37 G 161 | 38 L 162 | 39 H 163 | 40 F 164 |
■ | |||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 S 165 | 42 Y 173 | 43 F 174 | 44 V 175 | 45 L 176 | 46 D 177 | 47 Y 178 | 48 I 179 | 49 N 180 | 50 G 181 | 51 G 182 | 52 E 183 | 53 L 184 | 54 F 185 | 55 Y 186 | 56 H 187 | 57 L 188 | 58 Q 189 | 59 R 190 | 60 Y 212 |
■ | ▲ | ■ | ■▲ | ■ | |||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 213 | 62 H 214 | 63 S 215 | 64 L 216 | 65 N 217 | 66 I 218 | 67 V 219 | 68 Y 220 | 69 R 221 | 70 D 222 | 71 L 223 | 72 K 224 | 73 P 225 | 74 E 226 | 75 N 227 | 76 I 228 | 77 L 229 | 78 L 230 | 79 L 238 | 80 T 239 |
■ | ■ | ||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 240 | 82 F 241 | 83 G 242 | 84 L 243 | 85 C 244 | |||||||||||||||
■ |
Binding affinities
ChEMBL ID:CHEMBL550795Bioaffinities: 4 records for 3 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | CaM-kinase kinase beta | 6.7 | 6.7 | 6.7 | pIC50 | 1 |
Homo sapiens | Serine/threonine-protein kinase Sgk1 | 5.9 | 5.9 | 7.4 | pIC50 | 2 |
Homo sapiens | Tyrosine-protein kinase receptor UFO | 6.7 | 6.7 | 6.7 | pIC50 | 1 |