1U46 - chain A | Tyrosine kinase, non-receptor, 2
Structure information
| PDB: | 1U46 |
| PubMed: | 15308621 |
| Release date: | 2004-08-31 |
| Resolution: | 2 Å |
| Kinase: | TNK2 (ACK) |
| Family: | Ack |
| Group: | TK |
| Species: | HUMAN |
| Quality Score: | 6 |
| Missing Residues: | 5 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (3Å) |
| ASP rotation (xDFG.81) : | 352° |
| PHE rotation (xDFG.82) : | 9° |
| Activation loop position: | -4.7Å |
| αC-helix position: | 18.4Å |
| G-rich loop angle: | - |
| G-rich loop distance: | - |
| G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I4
H-bond protein
Binding pocket sequence
| Uniprot | EKLGDGSFGVVRRVAVKCLDFIREVNAMHSLDRNLIRLYGVKMVTELAPLGSLLDRLRKYLESKRFIHRDLAARNLLLIGDFGLM |
| Structure: | EKLG____GVVRRVAVKC_DFIREVNAMHSLDRNLIRLYGVKMVTELAPLGSLLDRLRKYLESKRFIHRDLAARNLLLIGDFGLM |
Modified residues
No modified residues identified.