3ZZW - chain A (model B) | Receptor tyrosine kinase-like orphan receptor 2
Structure information
PDB: | 3ZZW |
PubMed: | - |
Release date: | 2011-09-14 |
Resolution: | 2.9 Å |
Kinase: | ROR2 |
Family: | Ror |
Group: | TK |
Species: | HUMAN |
Quality Score: | 7.2 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | out-like |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (4.6Å) |
ASP rotation (xDFG.81) : | 173° |
PHE rotation (xDFG.82) : | 228° |
Activation loop position: | -0.1Å |
αC-helix position: | 21.8Å |
G-rich loop angle: | 72.8° |
G-rich loop distance: | 20.8Å |
G-rich loop rotation: | 74.7° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I9
H-bond protein
Binding pocket sequence
Uniprot | EELGEDRFGKVYKVAIKTLEFRHEAMLRARLQPNVVCLLGVSMIFSYCSHGDLHEFLVMYLSSHHVVHKDLATRNVLVISDLGLF |
Structure: | EELGEDRFGKVYKVAIKTLEFRHEAMLRARLQPNVVCLLGVSMIFSYCSHGDLHEFLVMYLSSHHVVHKDLATRNVLVISDLGLF |
Modified residues
No modified residues identified.