Receptor tyrosine kinase-like orphan receptor 2
Kinase structure
Kinase:ROR2
Family:Ror
Group:TK
Species:HUMAN
PDB:3ZZW
sc-PDB:
KIDFamMap:Search
Release date:2011-09-14
Chain:A
(Alternate) Model:B
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 3ZZW
3ZZWAlternative model: AChain: A
3ZZWAlternative model: AChain: B
3ZZWAlternative model: BChain: B


Structural information
DFG conformation:out-like
αC-helix conformation:out
G-rich loop angle (distance):72.8° (20.8Å)
G-rich loop rotation:74.7°
Quality Score:7.2
Resolution:2.9 Å
Missing Residues:0
Missing Atoms:0
Ligand binding mode
Waters
Cluster
I9
Ligand
No
Protein
Yes

Pocket alignment
Uniprot sequence:EELGEDRFGKVYKVAIKTLEFRHEAMLRARLQPNVVCLLGVSMIFSYCSHGDLHEFLVMYLSSHHVVHKDLATRNVLVISDLGLF
Sequence structure:EELGEDRFGKVYKVAIKTLEFRHEAMLRARLQPNVVCLLGVSMIFSYCSHGDLHEFLVMYLSSHHVVHKDLATRNVLVISDLGLF