3ZZW - chain B (model A) | Receptor tyrosine kinase-like orphan receptor 2
Structure information
PDB: | 3ZZW |
PubMed: | - |
Release date: | 2011-09-14 |
Resolution: | 2.9 Å |
Kinase: | ROR2 |
Family: | Ror |
Group: | TK |
Species: | HUMAN |
Quality Score: | 6.7 |
Missing Residues: | 0 |
Missing Atoms: | 9 |
DFG conformation: | out |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (5Å) |
ASP rotation (xDFG.81) : | 108° |
PHE rotation (xDFG.82) : | 155° |
Activation loop position: | 3.7Å |
αC-helix position: | 21.8Å |
G-rich loop angle: | 70.8° |
G-rich loop distance: | 20.3Å |
G-rich loop rotation: | 76.2° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | EELGEDRFGKVYKVAIKTLEFRHEAMLRARLQPNVVCLLGVSMIFSYCSHGDLHEFLVMYLSSHHVVHKDLATRNVLVISDLGLF |
Structure: | EELGEDRFGKVYKVAIKTLEFRHEAMLRARLQPNVVCLLGVSMIFSYCSHGDLHEFLVMYLSSHHVVHKDLATRNVLVISDLGLF |
Modified residues
No modified residues identified.