3KN6 - chain B | Ribosomal protein S6 kinase A5 (2nd domain)
Structure information
| PDB: | 3KN6 |
| PubMed: | 20382163 |
| Release date: | 2010-04-21 |
| Resolution: | 2 Å |
| Kinase: | RPS6KA5-b (MSK1-b) |
| Family: | RSKb |
| Group: | CAMK |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (2.6Å) |
| ASP rotation (xDFG.81) : | 338° |
| PHE rotation (xDFG.82) : | 0° |
| Activation loop position: | -3.9Å |
| αC-helix position: | 18.3Å |
| G-rich loop angle: | 54.6° |
| G-rich loop distance: | 16.6Å |
| G-rich loop rotation: | 53.1° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I8
H-bond protein
Binding pocket sequence
| Uniprot | KPLGEGSFSICRKFAVKIINTQKEITALKLCEPNIVKLHEVFLVMELLNGGELFERIKKHMHDVGVVHRDLKPENLLFIIDFGFA |
| Structure: | KPLGEGSFSICRKFAVKIINTQKEITALKLCEPNIVKLHEVFLVMELLNGGELFERIKKHMHDVGVVHRDLKPENLLFIIDFGFA |
Modified residues
No modified residues identified.