3DBQ - chain A | TTK protein kinase
Structure information
| PDB: | 3DBQ |
| PubMed: | 19120698 |
| Release date: | 2009-02-10 |
| Resolution: | 2.7 Å |
| Kinase: | TTK |
| Family: | TTK |
| Group: | Other |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | No (6.6Å) |
| ASP rotation (xDFG.81) : | 333° |
| PHE rotation (xDFG.82) : | 344° |
| Activation loop position: | -6.4Å |
| αC-helix position: | 17.7Å |
| G-rich loop angle: | 64.3° |
| G-rich loop distance: | 19.7Å |
| G-rich loop rotation: | 4.1° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | KQIGSGGSSKVFQYAIKYVSYRNEIAYLNKLQDKIIRLYDYYMVMECGN-IDLNSWLKKTIHQHGIVHSDLKPANFLILIDFGIA |
| Structure: | KQIGSGGSSKVFQYAIKYVSYRNEIAYLNKLQDKIIRLYDYYMVMECGN_IDLNSWLKKTIHQHGIVHSDLKPANFLILIDFGIA |
Modified residues
No modified residues identified.