3CEK - chain A | TTK protein kinase
Structure information
PDB: | 3CEK |
PubMed: | 20383151 |
Release date: | 2008-03-18 |
Resolution: | 2.3 Å |
Kinase: | TTK |
Family: | TTK |
Group: | Other |
Species: | HUMAN |
Quality Score: | 9 |
Missing Residues: | 0 |
Missing Atoms: | 10 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No (6.6Å) |
ASP rotation (xDFG.81) : | 0° |
PHE rotation (xDFG.82) : | 343° |
Activation loop position: | -6.3Å |
αC-helix position: | 17.5Å |
G-rich loop angle: | 58.9° |
G-rich loop distance: | 18.1Å |
G-rich loop rotation: | 62.2° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | KQIGSGGSSKVFQYAIKYVSYRNEIAYLNKLQDKIIRLYDYYMVMECGN-IDLNSWLKKTIHQHGIVHSDLKPANFLILIDFGIA |
Structure: | KQIGSGGSSKVFQYAIKYVSYRNEIAYLNKLQDKIIRLYDYYMVMECGN_IDLNSWLKKTIHQHGIVHSDLKPANFLILIDFGIA |
Modified residues
No modified residues identified.