4C4E - chain A (model B) | TTK protein kinase
Structure information
| PDB: | 4C4E |
| PubMed: | 24256217 |
| Release date: | 2013-12-04 |
| Resolution: | 2.6 Å |
| Kinase: | TTK |
| Family: | TTK |
| Group: | Other |
| Species: | HUMAN |
| Quality Score: | 8.5 |
| Missing Residues: | 0 |
| Missing Atoms: | 15 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | No (6.8Å) |
| ASP rotation (xDFG.81) : | 339° |
| PHE rotation (xDFG.82) : | 344° |
| Activation loop position: | -6.4Å |
| αC-helix position: | 17.5Å |
| G-rich loop angle: | 60.1° |
| G-rich loop distance: | 18.7Å |
| G-rich loop rotation: | 55.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I2
No H-bonds
Binding pocket sequence
| Uniprot | KQIGSGGSSKVFQYAIKYVSYRNEIAYLNKLQDKIIRLYDYYMVMECGN-IDLNSWLKKTIHQHGIVHSDLKPANFLILIDFGIA |
| Structure: | KQIGSGGSSKVFQYAIKYVSYRNEIAYLNKLQDKIIRLYDYYMVMECGN_IDLNSWLKKTIHQHGIVHSDLKPANFLILIDFGIA |
Modified residues
Residue 686 (not in pocket)
Phosphorylated threonine