2RSV - chain A (model 5) | Vaccinia related kinase 1
Structure information
| PDB: | 2RSV |
| PubMed: | - |
| Release date: | 2013-12-04 |
| Resolution: | NMR |
| Kinase: | VRK1 |
| Family: | VRK |
| Group: | CK1 |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (3.3Å) |
| ASP rotation (xDFG.81) : | 352° |
| PHE rotation (xDFG.82) : | 359° |
| Activation loop position: | -4.3Å |
| αC-helix position: | 16.5Å |
| G-rich loop angle: | 64.1° |
| G-rich loop distance: | 19.4Å |
| G-rich loop rotation: | 28.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | LPIGQGGFGCIYLCVVKVEPLFTELKFYQRAALGVPKYWGSFMIMDRFG-SDLQKIYEAYIHEHEYVHGDIKASNLLLLVDYGLA |
| Structure: | LPIGQGGFGCIYLCVVKVEPLFTELKFYQRAALGVPKYWGSFMIMDRFG_SDLQKIYEAYIHEHEYVHGDIKASNLLLLVDYGLA |
Modified residues
No modified residues identified.