2KTY - chain A (model 15) | Vaccinia related kinase 1
Structure information
PDB: | 2KTY |
PubMed: | - |
Release date: | 2011-02-16 |
Resolution: | NMR |
Kinase: | VRK1 |
Family: | VRK |
Group: | CK1 |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (3.5Å) |
ASP rotation (xDFG.81) : | 45° |
PHE rotation (xDFG.82) : | 26° |
Activation loop position: | -4.1Å |
αC-helix position: | 16.7Å |
G-rich loop angle: | 57.7° |
G-rich loop distance: | 16.8Å |
G-rich loop rotation: | 101.1° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | LPIGQGGFGCIYLCVVKVEPLFTELKFYQRAALGVPKYWGSFMIMDRFG-SDLQKIYEAYIHEHEYVHGDIKASNLLLLVDYGLA |
Structure: | LPIGQGGFGCIYLCVVKVEPLFTELKFYQRAALGVPKYWGSFMIMDRFG_SDLQKIYEAYIHEHEYVHGDIKASNLLLLVDYGLA |
Modified residues
No modified residues identified.