4AE9 - chain B (model A) | Protein kinase cAMP-activated catalytic subunit alpha
Structure information
| PDB: | 4AE9 |
| PubMed: | 22504716 |
| Release date: | 2012-04-18 |
| Resolution: | 2.3 Å |
| Kinase: | PRKACA (PKACa) |
| Family: | PKA |
| Group: | AGC |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (4.4Å) |
| ASP rotation (xDFG.81) : | 4° |
| PHE rotation (xDFG.82) : | 17° |
| Activation loop position: | -4.9Å |
| αC-helix position: | 16.8Å |
| G-rich loop angle: | 64.8° |
| G-rich loop distance: | 20.8Å |
| G-rich loop rotation: | 82.2° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I10
H-bond protein
Binding pocket sequence
| Uniprot | KTLGTGSFGRVMLYAMKILHTLNEKRILQAVNPFLVKLEFSYMVMEYVPGGEMFSHLRRYLHSLDLIYRDLKPENLLIVTDFGFA |
| Structure: | KTLGTGSFGRVMLYAMKILHTLNEKRILQAVNPFLVKLEFSYMVMEYVPGGEMFSHLRRYLHSLDLIYRDLKPENLLIVTDFGFA |
Modified residues
Residue 139 (not in pocket)
Phosphorylated serine
Residue 197 (not in pocket)
Phosphorylated threonine
Residue 338 (not in pocket)
Phosphorylated serine