4CRS - chain A | Protein kinase N2
Structure information
PDB: | 4CRS |
PubMed: | - |
Release date: | 2014-03-12 |
Resolution: | 2.75 Å |
Kinase: | PKN2 |
Family: | PKN |
Group: | AGC |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.7Å) |
ASP rotation (xDFG.81) : | 345° |
PHE rotation (xDFG.82) : | 0° |
Activation loop position: | -3.8Å |
αC-helix position: | 18.3Å |
G-rich loop angle: | 49.3° |
G-rich loop distance: | 15Å |
G-rich loop rotation: | 60.7° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | AVLGRGHFGKVLLFAIKALSLMCEKRIFETVNPFLVNLFACCFVMEYAAGGDLMMHIHTYLHEHKIVYRDLKLDNLLLIADFGLC |
Structure: | AVLLRGHFGKVLLFAIKALSLMCEKRIFETVNPFLVNLFACCFVMEYAAGGDLMMHIHTYLHEHKIVYRDLKLDNLLLIADFGLC |
Modified residues
Residue 755 (not in pocket)
Phosphorylated serine
Residue 816 (not in pocket)
Phosphorylated threonine
Residue 958 (not in pocket)
Phosphorylated threonine
Orthosteric ligand
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 A 661 | 2 V 662 | 3 L 663 | 4 L 664 | 5 R 665 | 6 G 666 | 7 H 667 | 8 F 668 | 9 G 669 | 10 K 670 | 11 V 671 | 12 L 672 | 13 L 673 | 14 F 683 | 15 A 684 | 16 I 685 | 17 K 686 | 18 A 687 | 19 L 688 | 20 S 701 |
■ | ■ | ■ | ■ | ■ | ■ | ■ | ▲ | ||||||||||||
αC | b.l | IV | |||||||||||||||||
21 L 702 | 22 M 703 | 23 C 704 | 24 E 705 | 25 K 706 | 26 R 707 | 27 I 708 | 28 F 709 | 29 E 710 | 30 T 711 | 31 V 712 | 32 N 713 | 33 P 718 | 34 F 719 | 35 L 720 | 36 V 721 | 37 N 722 | 38 L 723 | 39 F 724 | 40 A 725 |
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 C 726 | 42 C 734 | 43 F 735 | 44 V 736 | 45 M 737 | 46 E 738 | 47 Y 739 | 48 A 740 | 49 A 741 | 50 G 742 | 51 G 743 | 52 D 744 | 53 L 745 | 54 M 746 | 55 M 747 | 56 H 748 | 57 I 749 | 58 H 750 | 59 T 751 | 60 Y 772 |
■ | ▲ | ■♦ | ■▲ | ▲ | |||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 773 | 62 H 774 | 63 E 775 | 64 H 776 | 65 K 777 | 66 I 778 | 67 V 779 | 68 Y 780 | 69 R 781 | 70 D 782 | 71 L 783 | 72 K 784 | 73 L 785 | 74 D 786 | 75 N 787 | 76 L 788 | 77 L 789 | 78 L 790 | 79 I 798 | 80 A 799 |
▲ | ■ | ||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 800 | 82 F 801 | 83 G 802 | 84 L 803 | 85 C 804 | |||||||||||||||
Binding affinities
ChEMBL ID:CHEMBL131890Bioaffinities: No (p)Ki/(p)IC50/(p)EC50 values for kinases found (with a ChEMBL confidence ≥ 8).