4IAN - chain A | Pre-mRNA processing factor 4B
Structure information
| PDB: | 4IAN |
| PubMed: | 24003220 |
| Release date: | 2013-08-28 |
| Resolution: | 2.44 Å |
| Kinase: | PRPF4B (PRP4) |
| Family: | DYRK |
| Group: | CMGC |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (2.5Å) |
| ASP rotation (xDFG.81) : | 342° |
| PHE rotation (xDFG.82) : | 7° |
| Activation loop position: | -3.2Å |
| αC-helix position: | 17.3Å |
| G-rich loop angle: | 50.6° |
| G-rich loop distance: | 15.4Å |
| G-rich loop rotation: | 44.2° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I1
H-bond protein
Binding pocket sequence
| Uniprot | GYTGQGVFSNVVRVAVKIITGLKELEFLKKLNFHCLRLFRHCLVFEPLS-MNLREVLKKLLKRCNILHADIKPDNILVLCDFGSA |
| Structure: | GYTGQGVFSNVVRVAVKIITGLKELEFLKKLNFHCLRLFRHCLVFEPLS_MNLREVLKKLLKRCNILHADIKPDNILVLCDFGSA |
Modified residues
Residue 849 (not in pocket)
Phosphorylated tyrosine