3L8P - chain A | TEK receptor tyrosine kinase
Structure information
PDB: | 3L8P |
PubMed: | - |
Release date: | 2010-10-06 |
Resolution: | 2.4 Å |
Kinase: | TEK (TIE2) |
Family: | Tie |
Group: | TK |
Species: | HUMAN |
Quality Score: | 7.6 |
Missing Residues: | 1 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (8.6Å) |
ASP rotation (xDFG.81) : | 347° |
PHE rotation (xDFG.82) : | 321° |
Activation loop position: | -5Å |
αC-helix position: | 21.9Å |
G-rich loop angle: | 50.7° |
G-rich loop distance: | 15.1Å |
G-rich loop rotation: | 75.2° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | DVIGEGNFGQVLKAAIKRMDFAGELEVLCKLGPNIINLLGAYLAIEYAPHGNLLDFLRKYLSQKQFIHRDLAARNILVIADFGLS |
Structure: | DVIGEGNFGQVLKAAIKRM_FAGELEVLCKLGPNIINLLGAYLAIEYAPHGNLLDFLRKYLSQKQFIHRDLAARNILVIADFGLS |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: 0CE
Ligand Name: 2-methyl-11-(1-methylethyl)-8-[(2S)-tetrahydro-2H-pyran-2-yl]-2,11,12,13-tetrahydro-4H-indazolo[5,4-a]pyrrolo[3,4-c]carbazol-4-one
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 D 828 | 2 V 829 | 3 I 830 | 4 G 831 | 5 E 832 | 6 G 833 | 7 N 834 | 8 F 835 | 9 G 836 | 10 Q 837 | 11 V 838 | 12 L 839 | 13 K 840 | 14 A 852 | 15 A 853 | 16 I 854 | 17 K 855 | 18 R 856 | 19 M 857 | 20 _ _ |
■ | ■ | ■ | ■ | ■ | ■ | ■ | |||||||||||||
αC | b.l | IV | |||||||||||||||||
21 F 869 | 22 A 870 | 23 G 871 | 24 E 872 | 25 L 873 | 26 E 874 | 27 V 875 | 28 L 876 | 29 C 877 | 30 K 878 | 31 L 879 | 32 G 880 | 33 P 883 | 34 N 884 | 35 I 885 | 36 I 886 | 37 N 887 | 38 L 888 | 39 L 889 | 40 G 890 |
■ | ■ | ||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 A 891 | 42 Y 899 | 43 L 900 | 44 A 901 | 45 I 902 | 46 E 903 | 47 Y 904 | 48 A 905 | 49 P 906 | 50 H 907 | 51 G 908 | 52 N 909 | 53 L 910 | 54 L 911 | 55 D 912 | 56 F 913 | 57 L 914 | 58 R 915 | 59 K 916 | 60 Y 954 |
■ | ■ | ■ | ■▲ | ■ | ■ | ■ | |||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 955 | 62 S 956 | 63 Q 957 | 64 K 958 | 65 Q 959 | 66 F 960 | 67 I 961 | 68 H 962 | 69 R 963 | 70 D 964 | 71 L 965 | 72 A 966 | 73 A 967 | 74 R 968 | 75 N 969 | 76 I 970 | 77 L 971 | 78 V 972 | 79 I 980 | 80 A 981 |
■ | ■ | ■ | ■ | ||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 982 | 82 F 983 | 83 G 984 | 84 L 985 | 85 S 986 | |||||||||||||||
■▲ | ■ |
Binding affinities
Ligand not found in ChEMBL.