Ribosomal protein S6 kinase A2 (2nd domain)
Kinase structure
Kinase:RPS6KA2-b (RSK1-b)
Family:RSKb
Group:CAMK
Species:HUMAN
PDB:3RNY
sc-PDB:
KIDFamMap:Search
Release date:2012-04-25
PubMed: 22683790
Chain:A
(Alternate) Model:B
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 3RNY
3RNYAlternative model: AChain: A
3RNYAlternative model: AChain: B
3RNYAlternative model: BChain: B


Structural information
DFG conformation:in
αC-helix conformation:in
G-rich loop angle (distance):-
G-rich loop rotation:-
Quality Score:4.4
Resolution:2.7 Å
Missing Residues:9
Missing Atoms:42
Ligand binding mode
Waters
Cluster
I1
I5
Ligand
No
No
Protein
Yes
Yes

Pocket alignment
Uniprot sequence:ETIGVGSYSECKRYAVKVIDPSEEIEILLRYGPNIITLKDVYLVTELMRGGELLDKILRYLHSQGVVHRDLKPSNILYICDFGFA
Sequence structure:ETI_______CKRYAVKVI_PSEEIEILLRYGPNIITLKDV_LVTELMRGGELLDKILRYLHSQGVVHRDLKPSNILYICDFGFA