3RNY - chain B (model A) | Ribosomal protein S6 kinase A1 (2nd domain)
Structure information
PDB: | 3RNY |
PubMed: | 22683790 |
Release date: | 2012-04-25 |
Resolution: | 2.7 Å |
Kinase: | RPS6KA1-b (RSK3-b) |
Family: | RSKb |
Group: | CAMK |
Species: | HUMAN |
Quality Score: | 5.2 |
Missing Residues: | 7 |
Missing Atoms: | 28 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.7Å) |
ASP rotation (xDFG.81) : | 355° |
PHE rotation (xDFG.82) : | 14° |
Activation loop position: | -4.5Å |
αC-helix position: | 18Å |
G-rich loop angle: | - |
G-rich loop distance: | - |
G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | ETIGVGSYSECKRYAVKVIDPSEEIEILLRYGPNIITLKDVYLVTELMRGGELLDKILRYLHSQGVVHRDLKPSNILYICDFGFA |
Structure: | ETI_______CKRYAVKVIDPSEEIEILLRYGPNIITLKDVYLVTELMRGGELLDKILRYLHSQGVVHRDLKPSNILYICDFGFA |
Modified residues
No modified residues identified.