Ribosomal protein S6 kinase polypeptide 3
Kinase structure
Kinase:Rps6ka3 (RSK2)
Family:RSK
Group:AGC
Species:MOUSE
PDB:3UBD
sc-PDB:
KIDFamMap:Search
Release date:2012-09-05
PubMed: 22846040
Chain:A
(Alternate) Model:A
Orthosteric ligand:SL0
2D structure of the orthosteric ligand
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 3UBD
3UBDAlternative model: BChain: A


Structural information
DFG conformation:out-like
αC-helix conformation:na
G-rich loop angle (distance):76.2° (22.1Å)
G-rich loop rotation:57.9°
Quality Score:3.6
Resolution:1.53 Å
Missing Residues:6
Missing Atoms:0
Ligand binding mode
PocketsSubpockets
front
BP-I-A

Pocket alignment
Uniprot sequence:KVLGQGSFGKVFLYAMKVLRTKMERDILVEVNPFIVKLHYAYLILDFLRGGDLFTRLSKHLHSLGIIYRDLKPENILLLTDFGLS
Sequence structure:KVLGQGSFGKVFLYAMKVL______DILVEVNPFIVKLHYAYLILDFLRGGDLFTRLSKHLHSLGIIYRDLKPENILLLTDFGLS

Ligand affinity
ChEMBL ID:CHEMBL240954
Bioaffinities: 10 records for 1 kinase
Species Kinase (ChEMBL naming) Median Min Max Type Records
Homo sapiensRibosomal protein S6 kinase alpha 36.467.1pIC5010


Kinase-ligand interaction pattern
Hydrophobic Aromatic face-to-face Aromatic face-to-edge H-bond donor H-bond acceptor Ionic positive Ionic negative
I g.l II III αC
1 K
72
2 V
73
3 L
74
4 G
75
5 Q
76
6 G
77
7 S
78
8 F
79
9 G
80
10 K
81
11 V
82
12 F
83
13 L
84
14 Y
97
15 A
98
16 M
99
17 K
100
18 V
101
19 L
102
20 _
_
αC b.l IV
21 _
_
22 _
_
23 _
_
24 _
_
25 _
_
26 D
120
27 I
121
28 L
122
29 V
123
30 E
124
31 V
125
32 N
126
33 P
128
34 F
129
35 I
130
36 V
131
37 K
132
38 L
133
39 H
134
40 Y
135
IV V GK hinge linker αD αE
41 A
136
42 Y
144
43 L
145
44 I
146
45 L
147
46 D
148
47 F
149
48 L
150
49 R
151
50 G
152
51 G
153
52 D
154
53 L
155
54 F
156
55 T
157
56 R
158
57 L
159
58 S
160
59 K
161
60 H
183
αE VI c.l VII VIII x
61 L
184
62 H
185
63 S
186
64 L
187
65 G
188
66 I
189
67 I
190
68 Y
191
69 R
192
70 D
193
71 L
194
72 K
195
73 P
196
74 E
197
75 N
198
76 I
199
77 L
200
78 L
201
79 L
209
80 T
210
DFG a.l
81 D
211
82 F
212
83 G
213
84 L
214
85 S
215

Interaction pattern search
Search KLIFS for kinase-ligand complexes with similar interaction patterns:
Specify the minimum similarity (0.00 no similarity, 1.00 identical)