C-abl oncogene 1, non-receptor tyrosine kinase
Kinase structure
Kinase:Abl1 (ABL1)
Family:Abl
Group:TK
Species:MOUSE
PDB:1M52
sc-PDB:
KIDFamMap:Search
Release date:2002-09-18
PubMed: 12154025
Chain:A
Orthosteric ligand:P17
2D structure of the orthosteric ligand
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 1M52
1M52Chain: B


Structural information
DFG conformation:out-like
αC-helix conformation:in
G-rich loop angle (distance):55.4° (16.8Å)
G-rich loop rotation:1.2°
Quality Score:8
Resolution:2.6 Å
Missing Residues:0
Missing Atoms:0
Ligand binding mode
PocketsSubpockets
front
gate
back
BP-I-A
BP-I-B

Pocket alignment
Uniprot sequence:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS
Sequence structure:HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS

Ligand affinity
ChEMBL ID:CHEMBL386051
Bioaffinities: 198 records for 148 kinases
Species Kinase (ChEMBL naming) Median Min Max Type Records
Homo sapiensActivin receptor type-16.86.86.8pKd1
Homo sapiensActivin receptor type-1B777pKd1
Homo sapiensActivin receptor type-2A888pKd1
Homo sapiensActivin receptor type-2B888pKd1
Homo sapiensBone morphogenetic protein receptor type-1A6.86.86.8pKd1
Homo sapiensBone morphogenetic protein receptor type-1B8.48.48.4pKd1
Homo sapiensBR serine/threonine-protein kinase 15.55.55.5pKd1
Homo sapiensBR serine/threonine-protein kinase 25.15.15.1pKd1
Homo sapiensc-Jun N-terminal kinase 15.85.85.8pKd1
Homo sapiensDiscoidin domain-containing receptor 27.97.97.9pKd1
Homo sapiensDual specificity mitogen-activated protein kinase kinase 16.16.16.1pKd1
Homo sapiensDual specificity mitogen-activated protein kinase kinase 25.75.75.7pKd1
Homo sapiensDual specificity mitogen-activated protein kinase kinase 35.35.35.3pKd1
Homo sapiensDual specificity mitogen-activated protein kinase kinase 46.56.56.5pKd1
Homo sapiensDual specificity mitogen-activated protein kinase kinase 57.27.27.2pKd1
Homo sapiensDual specificity mitogen-activated protein kinase kinase 65.45.45.4pKd1
Homo sapiensDual specificity testis-specific protein kinase 17.17.17.1pKd1
Homo sapiensEphrin type-A receptor 18.28.28.2pKd1
Homo sapiensEphrin type-A receptor 28.48.48.4pKd1
Homo sapiensEphrin type-A receptor 38.18.18.1pKd1
Homo sapiensEphrin type-A receptor 48.18.18.1pKd1
Homo sapiensEphrin type-A receptor 57.97.97.9pKd1
Homo sapiensEphrin type-A receptor 67.27.27.2pKd1
Homo sapiensEphrin type-A receptor 88.28.28.2pKd1
Homo sapiensEphrin type-B receptor 18.48.48.4pKd1
Homo sapiensEphrin type-B receptor 27.77.77.7pKd1
Homo sapiensEphrin type-B receptor 36.56.56.5pKd1
Homo sapiensEphrin type-B receptor 47.97.97.9pKd1
Homo sapiensEpidermal growth factor receptor erbB165.66.8pKd10
Homo sapiensEpithelial discoidin domain-containing receptor 18.68.68.6pKd1
Homo sapiensEukaryotic translation initiation factor 2-alpha kinase 47.67.67.6pKd1
Homo sapiensFibroblast growth factor receptor 15.95.95.9pIC501
Homo sapiensFibroblast growth factor receptor 17.27.27.2pKd1
Homo sapiensFibroblast growth factor receptor 27.57.57.5pKd1
Homo sapiensFibroblast growth factor receptor 37.37.37.3pKd2
Homo sapiensFibroblast growth factor receptor 46.36.36.3pKd1
Homo sapiensHepatocyte growth factor receptor6.166.1pKd3
Homo sapiensLeucine-rich repeat serine/threonine-protein kinase 25.15.15.3pKd2
Homo sapiensLIM domain kinase 1666pKd1
Homo sapiensLIM domain kinase 26.56.56.5pKd1
Homo sapiensMacrophage colony stimulating factor receptor9.29.29.2pKd1
Homo sapiensMacrophage-stimulating protein receptor5.65.65.6pKd1
Homo sapiensMAP kinase p38 alpha7.27.27.2pKd1
Homo sapiensMAP kinase p38 beta777pKd1
Homo sapiensMAP/microtubule affinity-regulating kinase 2555pKd1
Homo sapiensMisshapen-like kinase 16.26.26.2pKd1
Homo sapiensMitogen-activated protein kinase 4666pKd1
Homo sapiensMitogen-activated protein kinase 66.86.86.8pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 105.35.35.3pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 116.36.36.3pKd2
Homo sapiensMitogen-activated protein kinase kinase kinase 26.26.26.2pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 36.46.46.4pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 47.37.37.3pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase 96.46.46.4pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 16.76.76.7pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 25.95.95.9pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 36.46.46.4pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 46.16.16.1pKd1
Homo sapiensMitogen-activated protein kinase kinase kinase kinase 56.66.66.6pKd1
Homo sapiensMixed lineage kinase 76.56.56.5pKd1
Homo sapiensMyosin light chain kinase6.96.96.9pKd1
Homo sapiensmyosin light chain kinase 26.76.76.7pKd1
Homo sapiensNon-receptor tyrosine-protein kinase TNK16.46.46.4pKd1
Homo sapiensNT-3 growth factor receptor5.25.25.2pKd1
Homo sapiensPlatelet-derived growth factor receptor alpha8.38.38.3pKd1
Homo sapiensPlatelet-derived growth factor receptor beta8.98.98.9pKd1
Homo sapiensProtein tyrosine kinase 2 beta5.35.35.3pKd1
Homo sapiensPutative uncharacterized serine/threonine-protein kinase SgK110666pKd1
Homo sapiensReceptor-interacting serine/threonine-protein kinase 15.55.55.5pKd1
Homo sapiensReceptor protein-tyrosine kinase erbB-4666pKd1
Homo sapiensReceptor tyrosine-protein kinase erbB-36.96.96.9pKd1
Homo sapiensSerine/threonine-protein kinase 105.85.85.8pKd1
Homo sapiensSerine/threonine-protein kinase 25.45.45.4pKd1
Homo sapiensSerine/threonine-protein kinase 245.65.65.6pKd1
Homo sapiensSerine/threonine-protein kinase 255.65.65.6pKd1
Homo sapiensSerine/threonine-protein kinase 32A5.65.65.6pKd1
Homo sapiensSerine/threonine-protein kinase 32B5.95.95.9pKd1
Homo sapiensSerine/threonine-protein kinase 356.46.46.4pKd1
Homo sapiensSerine/threonine-protein kinase 366.56.56.5pKd1
Homo sapiensSerine/threonine-protein kinase Aurora-C5.35.35.3pKd1
Homo sapiensSerine/threonine-protein kinase B-raf8.28.28.4pKd2
Homo sapiensSerine/threonine-protein kinase c-TAK16.16.16.1pKd1
Homo sapiensSerine/threonine-protein kinase GAK8.18.18.1pKd1
Homo sapiensSerine/threonine-protein kinase MRCK-A5.95.95.9pKd1
Homo sapiensSerine/threonine-protein kinase MRCK beta666pKd1
Homo sapiensSerine/threonine-protein kinase MRCK gamma6.66.66.6pKd1
Homo sapiensSerine/threonine-protein kinase MST15.45.45.4pKd1
Homo sapiensSerine/threonine-protein kinase MST25.85.85.8pKd1
Homo sapiensSerine/threonine-protein kinase MST45.45.45.4pKd1
Homo sapiensSerine/threonine-protein kinase Nek15.15.15.1pKd1
Homo sapiensSerine/threonine-protein kinase Nek115.55.55.5pKd1
Homo sapiensSerine/threonine-protein kinase NEK2777pKd1
Homo sapiensSerine/threonine-protein kinase Nek56.16.16.1pKd1
Homo sapiensSerine/threonine-protein kinase NIM15.25.25.2pKd1
Homo sapiensSerine/threonine protein kinase NLK7.57.57.5pKd1
Homo sapiensSerine/threonine-protein kinase PLK35.75.75.7pKd1
Homo sapiensSerine/threonine-protein kinase RAF7.67.67.6pKd1
Homo sapiensSerine/threonine-protein kinase receptor R37.27.27.2pKd1
Homo sapiensSerine/threonine-protein kinase RIPK27.87.87.8pKd1
Homo sapiensSerine/threonine-protein kinase SIK18.28.28.2pKd1
Homo sapiensSerine/threonine-protein kinase SIK27.67.67.6pKd1
Homo sapiensSerine/threonine-protein kinase SIK3777pKd1
Homo sapiensSerine/threonine-protein kinase TAO16.16.16.1pKd1
Homo sapiensSerine/threonine-protein kinase TAO26.46.46.4pKd1
Homo sapiensSerine/threonine-protein kinase TAO36.46.46.4pKd1
Homo sapiensSerine/threonine-protein kinase TNNI3K7.37.37.3pKd1
Homo sapiensSerine/threonine-protein kinase WEE17.27.27.2pKd1
Homo sapiensSPS1/STE20-related protein kinase YSK46.66.66.6pKd1
Homo sapiensStem cell growth factor receptor7.56.38.8pKd7
Homo sapiensTGF-beta receptor type I5.85.85.8pKd1
Homo sapiensTGF-beta receptor type II6.66.66.6pKd1
Homo sapiensTRAF2- and NCK-interacting kinase6.46.46.4pKd1
Homo sapiensTyrosine- and threonine-specific cdc2-inhibitory kinase7.47.47.4pKd1
Homo sapiensTyrosine kinase non-receptor protein 27.67.67.6pKd1
Homo sapiensTyrosine-protein kinase ABL8.95.79.3pKd15
Homo sapiensTyrosine-protein kinase ABL9.79.79.7pKi1
Homo sapiensTyrosine-protein kinase ABL29.29.29.2pKd1
Homo sapiensTyrosine-protein kinase BLK8.88.88.8pKd1
Homo sapiensTyrosine-protein kinase BMX7.57.57.5pKd1
Homo sapiensTyrosine-protein kinase BRK7.37.37.3pKd1
Homo sapiensTyrosine-protein kinase BTK6.76.76.7pKd1
Homo sapiensTyrosine-protein kinase CSK7.27.27.2pKd1
Homo sapiensTyrosine-protein kinase FER5.55.55.5pKd1
Homo sapiensTyrosine-protein kinase FES6.26.26.2pKd1
Homo sapiensTyrosine-protein kinase FGR8.68.68.6pKd1
Homo sapiensTyrosine-protein kinase FRK8.48.48.4pKd1
Homo sapiensTyrosine-protein kinase FYN8.38.38.3pKd1
Homo sapiensTyrosine-protein kinase HCK8.58.58.5pKd1
Homo sapiensTyrosine-protein kinase JAK16.56.56.5pKd2
Homo sapiensTyrosine-protein kinase JAK2777pKd2
Homo sapiensTyrosine-protein kinase JAK36.36.36.3pKd2
Homo sapiensTyrosine-protein kinase LCK999pKd1
Homo sapiensTyrosine-protein kinase Lyn8.78.78.7pKd1
Homo sapiensTyrosine-protein kinase receptor FLT36.15.56.9pKd7
Homo sapiensTyrosine-protein kinase receptor RET7.25.27.3pKd3
Homo sapiensTyrosine-protein kinase receptor Tie-15.95.95.9pKd1
Homo sapiensTyrosine-protein kinase receptor TYRO36.46.46.4pKd1
Homo sapiensTyrosine-protein kinase SRC7.67.67.6pIC501
Homo sapiensTyrosine-protein kinase SRC9.29.29.2pKd1
Homo sapiensTyrosine-protein kinase Srms6.26.26.2pKd1
Homo sapiensTyrosine-protein kinase SYK6.46.46.4pKd1
Homo sapiensTyrosine-protein kinase TEC6.26.26.2pKd1
Homo sapiensTyrosine-protein kinase TIE-26.66.66.6pKd1
Homo sapiensTyrosine-protein kinase TXK7.57.57.5pKd1
Homo sapiensTyrosine-protein kinase TYK26.46.46.4pKd2
Homo sapiensTyrosine-protein kinase YES8.68.68.6pKd1
Homo sapiensUncharacterized aarF domain-containing protein kinase 47.67.67.6pKd1
Homo sapiensVascular endothelial growth factor receptor 17.67.67.6pKd1
Homo sapiensVascular endothelial growth factor receptor 26.26.26.2pKd1
Homo sapiensVascular endothelial growth factor receptor 36.16.16.1pKd1
Homo sapiensWee1-like protein kinase 27.27.27.2pKd1


Kinase-ligand interaction pattern
Hydrophobic Aromatic face-to-face Aromatic face-to-edge H-bond donor H-bond acceptor Ionic positive Ionic negative
I g.l II III αC
1 H
246
2 K
247
3 L
248
4 G
249
5 G
250
6 G
251
7 Q
252
8 Y
253
9 G
254
10 E
255
11 V
256
12 Y
257
13 E
258
14 V
268
15 A
269
16 V
270
17 K
271
18 T
272
19 L
273
20 E
282
αC b.l IV
21 F
283
22 L
284
23 K
285
24 E
286
25 A
287
26 A
288
27 V
289
28 M
290
29 K
291
30 E
292
31 I
293
32 K
294
33 P
296
34 N
297
35 L
298
36 V
299
37 Q
300
38 L
301
39 L
302
40 G
303
IV V GK hinge linker αD αE
41 V
304
42 Y
312
43 I
313
44 I
314
45 T
315
46 E
316
47 F
317
48 M
318
49 T
319
50 Y
320
51 G
321
52 N
322
53 L
323
54 L
324
55 D
325
56 Y
326
57 L
327
58 R
328
59 E
329
60 Y
353
αE VI c.l VII VIII x
61 L
354
62 E
355
63 K
356
64 K
357
65 N
358
66 F
359
67 I
360
68 H
361
69 R
362
70 D
363
71 L
364
72 A
365
73 A
366
74 R
367
75 N
368
76 C
369
77 L
370
78 V
371
79 V
379
80 A
380
DFG a.l
81 D
381
82 F
382
83 G
383
84 L
384
85 S
385

Interaction pattern search
Search KLIFS for kinase-ligand complexes with similar interaction patterns:
Specify the minimum similarity (0.00 no similarity, 1.00 identical)