2QR8 - chain A (model B) | Ribosomal protein S6 kinase polypeptide 3 (2nd domain)
Structure information
PDB: | 2QR8 |
PubMed: | 18084304 |
Release date: | 2007-12-11 |
Resolution: | 2 Å |
Kinase: | Rps6ka3-b (RSK2-b) |
Family: | RSKb |
Group: | CAMK |
Species: | MOUSE |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.7Å) |
ASP rotation (xDFG.81) : | 335° |
PHE rotation (xDFG.82) : | 8° |
Activation loop position: | -3.6Å |
αC-helix position: | 17.9Å |
G-rich loop angle: | 56.5° |
G-rich loop distance: | 17.2Å |
G-rich loop rotation: | 25.9° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I4
H-bond protein
Binding pocket sequence
Uniprot | EDIGVGSYSVCKRFAVKIIDPTEEIEILLRYGPNIITLKDVYVVTELMKGGELLDKILRYLHAQGVVHRDLKPSNILYICDFGFA |
Structure: | EDIGVGSYSVCKRFAVKIIDPTEEIEILLRYGPNIITLKDVYVVTELMKGGELLDKILRYLHAQGVVHRDLKPSNILYICDFGFA |
Modified residues
No modified residues identified.