2QR8 - chain A (model B) | Ribosomal protein S6 kinase polypeptide 3 (2nd domain)
Structure information
| PDB: | 2QR8 |
| PubMed: | 18084304 |
| Release date: | 2007-12-11 |
| Resolution: | 2 Å |
| Kinase: | Rps6ka3-b (RSK2-b) |
| Family: | RSKb |
| Group: | CAMK |
| Species: | MOUSE |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (2.7Å) |
| ASP rotation (xDFG.81) : | 335° |
| PHE rotation (xDFG.82) : | 8° |
| Activation loop position: | -3.6Å |
| αC-helix position: | 17.9Å |
| G-rich loop angle: | 56.5° |
| G-rich loop distance: | 17.2Å |
| G-rich loop rotation: | 25.9° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I4
H-bond protein
Binding pocket sequence
| Uniprot | EDIGVGSYSVCKRFAVKIIDPTEEIEILLRYGPNIITLKDVYVVTELMKGGELLDKILRYLHAQGVVHRDLKPSNILYICDFGFA |
| Structure: | EDIGVGSYSVCKRFAVKIIDPTEEIEILLRYGPNIITLKDVYVVTELMKGGELLDKILRYLHAQGVVHRDLKPSNILYICDFGFA |
Modified residues
No modified residues identified.