4M66 - chain B (model B) | Receptor-interacting serine-threonine kinase 3
Structure information
| PDB: | 4M66 |
| PubMed: | 24095729 |
| Release date: | 2013-10-16 |
| Resolution: | 2.4 Å |
| Kinase: | Ripk3 (RIPK3) |
| Family: | RIPK |
| Group: | TKL |
| Species: | MOUSE |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (2.4Å) |
| ASP rotation (xDFG.81) : | 343° |
| PHE rotation (xDFG.82) : | 10° |
| Activation loop position: | -3.5Å |
| αC-helix position: | 18.1Å |
| G-rich loop angle: | 50.8° |
| G-rich loop distance: | 15.5Å |
| G-rich loop rotation: | 42.7° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | EFVGKGGFGVVFRVAVKIVKISWEVKAMVNLRENVLLLLGVALVTRFMENGSLAGLLQPHSLNPPLLHRDLKPSNILLLADFGLS |
| Structure: | EFVGKGGFGVVFRVAVKIVKISWEVKAMVNLRENVLLLLGVALVTRFMENGSLAGLLQPHSLDPPLLHRDLKPSNILLLADFGLS |
Modified residues
No modified residues identified.