4DFY - chain A | Protein kinase, cAMP dependent, catalytic, alpha
Structure information
| PDB: | 4DFY |
| PubMed: | 22334660 |
| Release date: | 2012-02-15 |
| Resolution: | 3 Å |
| Kinase: | Prkaca (PKACa) |
| Family: | PKA |
| Group: | AGC |
| Species: | MOUSE |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 36 |
| DFG conformation: | in |
| αC-helix conformation: | out |
| Salt bridge KIII.17 and EαC.24: | No |
| ASP rotation (xDFG.81) : | 332° |
| PHE rotation (xDFG.82) : | 312° |
| Activation loop position: | -4.5Å |
| αC-helix position: | 21.2Å |
| G-rich loop angle: | 71.1° |
| G-rich loop distance: | 21.2Å |
| G-rich loop rotation: | 126.2° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | KTLGTGSFGRVMLYAMKILHTLNEKRILQAVNPFLVKLEFSYMVMEYVAGGEMFSHLRRYLHSLDLIYRDLKPENLLIVTDFGFA |
| Structure: | KTLGTGSFGRVMLYAMKILHTLNEKRILQAVNPFLVKLEFSYMVMEYVAGGEMFSHLRRYLHSLDLIYRDLKPENLLIVTDFGFA |
Modified residues
Residue 338 (not in pocket)
Phosphorylated serine