3TNP - chain F | Protein kinase, cAMP dependent, catalytic, alpha
Structure information
PDB: | 3TNP |
PubMed: | 22323819 |
Release date: | 2012-02-01 |
Resolution: | 2.3 Å |
Kinase: | Prkaca (PKACa) |
Family: | PKA |
Group: | AGC |
Species: | MOUSE |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.9Å) |
ASP rotation (xDFG.81) : | 351° |
PHE rotation (xDFG.82) : | 11° |
Activation loop position: | -4.1Å |
αC-helix position: | 17.9Å |
G-rich loop angle: | 49.5° |
G-rich loop distance: | 15.5Å |
G-rich loop rotation: | 54.9° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I1
H-bond protein
I8
H-bond protein
Binding pocket sequence
Uniprot | KTLGTGSFGRVMLYAMKILHTLNEKRILQAVNPFLVKLEFSYMVMEYVAGGEMFSHLRRYLHSLDLIYRDLKPENLLIVTDFGFA |
Structure: | KTLGTGSFGRVMLYAMKILHTLNEKRILQAVNPFLVKLEFSYMVMEYVAGGEMFSHLRRYLHSLDLIYRDLKPENLLIVTDFGFA |
Modified residues
Residue 139 (not in pocket)
Phosphorylated serine
Residue 197 (not in pocket)
Phosphorylated threonine
Residue 338 (not in pocket)
Phosphorylated serine