5D9K - chain B | Ribosomal protein S6 kinase A3
Structure information
PDB: | 5D9K |
PubMed: | 24554780 |
Release date: | 2015-09-02 |
Resolution: | 2.55 Å |
Kinase: | RPS6KA3 (RSK2) |
Family: | RSK |
Group: | AGC |
Species: | HUMAN |
Quality Score: | 9.2 |
Missing Residues: | 0 |
Missing Atoms: | 8 |
DFG conformation: | out-like |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No |
ASP rotation (xDFG.81) : | 105° |
PHE rotation (xDFG.82) : | 240° |
Activation loop position: | -1.3Å |
αC-helix position: | 18.8Å |
G-rich loop angle: | 60.4° |
G-rich loop distance: | 18.3Å |
G-rich loop rotation: | 45.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I2
H-bond protein
Binding pocket sequence
Uniprot | KVLGQGSFGKVFLYAMKVLRTKMERDILVEVNPFIVKLHYAYLILDFLRGGDLFTRLSKHLHSLGIIYRDLKPENILLLTDFGLS |
Structure: | KVLGQGSFGKVFLYAMKVLRTKMERDILVEVNPFIVKLHYAYLILDFLRGGDLFTRLSKHLHSLGIIYRDLKPENILLLTDFGLS |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: 584
Ligand Name: (7R)-2-[(3,5-difluoro-4-hydroxyphenyl)amino]-5,7-dimethyl-8-(3-methylbutyl)-7,8-dihydropteridin-6(5H)-one
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 K 72 | 2 V 73 | 3 L 74 | 4 G 75 | 5 Q 76 | 6 G 77 | 7 S 78 | 8 F 79 | 9 G 80 | 10 K 81 | 11 V 82 | 12 F 83 | 13 L 84 | 14 Y 97 | 15 A 98 | 16 M 99 | 17 K 100 | 18 V 101 | 19 L 102 | 20 R 114 |
■ | ■ | ■ | ■ | ■ | ■ | ||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 T 115 | 22 K 116 | 23 M 117 | 24 E 118 | 25 R 119 | 26 D 120 | 27 I 121 | 28 L 122 | 29 V 123 | 30 E 124 | 31 V 125 | 32 N 126 | 33 P 128 | 34 F 129 | 35 I 130 | 36 V 131 | 37 K 132 | 38 L 133 | 39 H 134 | 40 Y 135 |
■ | |||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 A 136 | 42 Y 144 | 43 L 145 | 44 I 146 | 45 L 147 | 46 D 148 | 47 F 149 | 48 L 150 | 49 R 151 | 50 G 152 | 51 G 153 | 52 D 154 | 53 L 155 | 54 F 156 | 55 T 157 | 56 R 158 | 57 L 159 | 58 S 160 | 59 K 161 | 60 H 183 |
■ | ▲ | ■♦ | ■▲ | ■ | |||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 184 | 62 H 185 | 63 S 186 | 64 L 187 | 65 G 188 | 66 I 189 | 67 I 190 | 68 Y 191 | 69 R 192 | 70 D 193 | 71 L 194 | 72 K 195 | 73 P 196 | 74 E 197 | 75 N 198 | 76 I 199 | 77 L 200 | 78 L 201 | 79 L 209 | 80 T 210 |
■ | ■ | ||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 211 | 82 F 212 | 83 G 213 | 84 L 214 | 85 S 215 | |||||||||||||||
■▲ | ■♦ |
Binding affinities
ChEMBL ID:CHEMBL3604889Bioaffinities: 3 records for 2 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Ribosomal protein S6 kinase alpha 3 | 8.4 | 8.4 | 8.4 | pIC50 | 2 |
Mus musculus | Ribosomal protein S6 kinase alpha-3 | 6.3 | 6.3 | 6.3 | pEC50 | 1 |