5CEK - chain A | Tribbles pseudokinase 1
Structure information
| PDB: | 5CEK |
| PubMed: | 26455797 |
| Release date: | 2015-11-11 |
| Resolution: | 2.8 Å |
| Kinase: | TRIB1 (Trb1) |
| Family: | Trbl |
| Group: | CAMK |
| Species: | HUMAN |
| Quality Score: | 6 |
| Missing Residues: | 3 |
| Missing Atoms: | 0 |
| DFG conformation: | out-like |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | No |
| ASP rotation (xDFG.81) : | 191° |
| PHE rotation (xDFG.82) : | 226° |
| Activation loop position: | -2.1Å |
| αC-helix position: | 17.7Å |
| G-rich loop angle: | - |
| G-rich loop distance: | - |
| G-rich loop rotation: | - |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | LLLPLAEREHVSRLRCKVFYQDKIRPYIQLPSSNITGIVEVYVFFEKDF-GDMHSYVRSHCHQSAIVLGDLKLRKFVFLRLESLE |
| Structure: | LLLPLA___HVSRLRCKVFYQDKIRPYIQLPSSNITGIVEVYVFFEKDF_GDMHSYVRSHCHQSAIVLGDLKLRKFVFLRLESLE |
Modified residues
No modified residues identified.