4XG2 - chain A | Spleen tyrosine kinase
Structure information
| PDB: | 4XG2 |
| PubMed: | 27504936 |
| Release date: | 2015-12-30 |
| Resolution: | 2.21 Å |
| Kinase: | SYK |
| Family: | Syk |
| Group: | TK |
| Species: | HUMAN |
| Quality Score: | 6 |
| Missing Residues: | 5 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (2.8Å) |
| ASP rotation (xDFG.81) : | 0° |
| PHE rotation (xDFG.82) : | 16° |
| Activation loop position: | -3.6Å |
| αC-helix position: | 18Å |
| G-rich loop angle: | - |
| G-rich loop distance: | - |
| G-rich loop rotation: | - |
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I4
H-bond protein
I5
H-bond protein
Binding pocket sequence
| Uniprot | KELGSGNFGTVKKVAVKILELLAEANVMQQLDPYIVRMIGIMLVMEMAELGPLNKYLQQYLEESNFVHRDLAARNVLLISDFGLS |
| Structure: | _ELGS____TVKKVAVKILELLAEANVMQQLDPYIVRMIGIMLVMEMAELGPLNKYLQQYLEESNFVHRDLAARNVLLISDFGLS |
Modified residues
No modified residues identified.