5HES - chain B (model A) | Mitogen-activated protein kinase kinase kinase MLT
Structure information
PDB: | 5HES |
PubMed: | 26999302 |
Release date: | 2016-03-30 |
Resolution: | 2.14 Å |
Kinase: | MAP3K20 (ZAK) |
Family: | MLK |
Group: | TKL |
Species: | HUMAN |
Quality Score: | 9 |
Missing Residues: | 2 |
Missing Atoms: | 2 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (12.3Å) |
ASP rotation (xDFG.81) : | 333° |
PHE rotation (xDFG.82) : | 327° |
Activation loop position: | -4.4Å |
αC-helix position: | 21.3Å |
G-rich loop angle: | 59.2° |
G-rich loop distance: | 17.3Å |
G-rich loop rotation: | 15.3° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I3
H-bond protein
I10
H-bond ligand
Binding pocket sequence
Uniprot | ENCGGGSFGSVYRVAVKKLKIEKEAEILSVLSRNIIQFYGVGIVTEYASLGSLYDYINSMEAPVKVIHRDLKSRNVVIICDFGAS |
Structure: | ENCGGGSFGSVYRVAVKKLKIEKEAEILSVLSRNIIQFYGVGIVTEYASLGSLYDYINSMEAPVKVIHRDLKSRNVVIICDFG__ |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: 032
Ligand Name: N-(3-{[5-(4-chlorophenyl)-1H-pyrrolo[2,3-b]pyridin-3-yl]carbonyl}-2,4-difluorophenyl)propane-1-sulfonamide
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 E 20 | 2 N 21 | 3 C 22 | 4 G 23 | 5 G 24 | 6 G 25 | 7 S 26 | 8 F 27 | 9 G 28 | 10 S 29 | 11 V 30 | 12 Y 31 | 13 R 32 | 14 V 42 | 15 A 43 | 16 V 44 | 17 K 45 | 18 K 46 | 19 L 47 | 20 K 49 |
■ | ■ | ■♦ | ■ | ■ | ■ | ■ | |||||||||||||
αC | b.l | IV | |||||||||||||||||
21 I 50 | 22 E 51 | 23 K 52 | 24 E 53 | 25 A 54 | 26 E 55 | 27 I 56 | 28 L 57 | 29 S 58 | 30 V 59 | 31 L 60 | 32 S 61 | 33 R 63 | 34 N 64 | 35 I 65 | 36 I 66 | 37 Q 67 | 38 F 68 | 39 Y 69 | 40 G 70 |
■ | ■ | ■ | |||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 V 71 | 42 G 79 | 43 I 80 | 44 V 81 | 45 T 82 | 46 E 83 | 47 Y 84 | 48 A 85 | 49 S 86 | 50 L 87 | 51 G 88 | 52 S 89 | 53 L 90 | 54 Y 91 | 55 D 92 | 56 Y 93 | 57 I 94 | 58 N 95 | 59 S 96 | 60 M 123 |
■ | ■ | ▲ | ■♦♦ | ■▲ | ■ | ■ | |||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 E 124 | 62 A 125 | 63 P 126 | 64 V 127 | 65 K 128 | 66 V 129 | 67 I 130 | 68 H 131 | 69 R 132 | 70 D 133 | 71 L 134 | 72 K 135 | 73 S 136 | 74 R 137 | 75 N 138 | 76 V 139 | 77 V 140 | 78 I 141 | 79 I 149 | 80 C 150 |
■ | ■ | ||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 151 | 82 F 152 | 83 G 153 | 84 _ _ | 85 _ _ | |||||||||||||||
■▲ | ■ | ■▲ |
Binding affinities
ChEMBL ID:CHEMBL1229517Bioaffinities: 72 records for 12 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Dual specificity mitogen-activated protein kinase kinase 5 | 6.1 | 6.1 | 6.1 | pKd | 1 |
Homo sapiens | Mitogen-activated protein kinase kinase kinase kinase 5 | 5.8 | 5.8 | 5.8 | pKd | 1 |
Homo sapiens | Mixed lineage kinase 7 | 7.5 | 7.5 | 7.6 | pIC50 | 2 |
Homo sapiens | Mixed lineage kinase 7 | 6.5 | 6.5 | 6.5 | pKd | 1 |
Homo sapiens | Receptor-interacting serine/threonine-protein kinase 3 | 5.7 | 5.7 | 5.7 | pKd | 1 |
Homo sapiens | Serine/threonine-protein kinase A-Raf | 6 | 6 | 8.7 | pIC50 | 4 |
Homo sapiens | Serine/threonine-protein kinase A-Raf | 5.7 | 5.7 | 5.7 | pKd | 1 |
Homo sapiens | Serine/threonine-protein kinase B-raf | 5.6 | 5.6 | 6.1 | pEC50 | 2 |
Homo sapiens | Serine/threonine-protein kinase B-raf | 7.5 | 5.9 | 8.5 | pIC50 | 46 |
Homo sapiens | Serine/threonine-protein kinase B-raf | 7.2 | 5.5 | 7.3 | pKd | 3 |
Mus musculus | Serine/threonine-protein kinase B-raf | 7.5 | 7.5 | 7.5 | pIC50 | 1 |
Homo sapiens | Serine/threonine-protein kinase RAF | 6.9 | 6.4 | 7.3 | pIC50 | 5 |
Homo sapiens | Serine/threonine-protein kinase RIPK2 | 6.4 | 6.4 | 6.4 | pKd | 1 |
Homo sapiens | TGF-beta receptor type II | 5.5 | 5.5 | 5.5 | pKd | 1 |
Homo sapiens | Tyrosine-protein kinase BRK | 5.9 | 5.9 | 5.9 | pKd | 1 |
Homo sapiens | Vascular endothelial growth factor receptor 2 | 6.4 | 6.4 | 6.4 | pIC50 | 1 |