Ribosomal protein S6 kinase A2 (2nd domain)
Kinase structure
Kinase:RPS6KA2-b (RSK1-b)
Family:RSKb
Group:CAMK
Species:HUMAN
PDB:2WNT
sc-PDB:
KIDFamMap:Search
Release date:2009-08-25
Chain:A
(Alternate) Model:A
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 2WNT
2WNTAlternative model: AChain: B
2WNTAlternative model: BChain: A
2WNTAlternative model: BChain: B


Structural information
DFG conformation:in
αC-helix conformation:in
G-rich loop angle (distance):51.3° (15.5Å)
G-rich loop rotation:52.6°
Quality Score:8
Resolution:2.4 Å
Missing Residues:0
Missing Atoms:21
Ligand binding mode
Waters
Cluster
I1
I5
Ligand
No
No
Protein
Yes
Yes

Pocket alignment
Uniprot sequence:ETIGVGSYSECKRYAVKVIDPSEEIEILLRYGPNIITLKDVYLVTELMRGGELLDKILRYLHSQGVVHRDLKPSNILYICDFGFA
Sequence structure:ETIGVGSYSECKRYAVKVIDPSEEIEILLRYGPNIITLKDVYLVTELMRGGELLDKILRYLHSQGVVHRDLKPSNILYICDFGFA