5CWZ - chain B | TRAF2 and NCK interacting kinase
Structure information
PDB: | 5CWZ |
PubMed: | 27562646 |
Release date: | 2016-07-27 |
Resolution: | 2.9 Å |
Kinase: | TNIK |
Family: | STE20 |
Group: | STE |
Species: | HUMAN |
Quality Score: | 6.8 |
Missing Residues: | 3 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (5.4Å) |
ASP rotation (xDFG.81) : | 317° |
PHE rotation (xDFG.82) : | 296° |
Activation loop position: | -5Å |
αC-helix position: | 19.9Å |
G-rich loop angle: | 49.1° |
G-rich loop distance: | 14.9Å |
G-rich loop rotation: | 54.3° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | ELVGNGTYGQVYKAAIKVMEIKQEINMLKKYSRNIATYYGAWLVMEFCGAGSVTDLIKNHLHQHKVIHRDIKGQNVLLLVDFGVS |
Structure: | ELVGNG__GQVYKAAIKVMEIKQEINMLKKYSRNIATYYGAWLVMEFCGAGSVTDLIKNHLHQHKVIHRDIKGQNVLLLVDFGV_ |
Modified residues
No modified residues identified.