5CWZ - chain A | TRAF2 and NCK interacting kinase
Structure information
| PDB: | 5CWZ |
| PubMed: | 27562646 |
| Release date: | 2016-07-27 |
| Resolution: | 2.9 Å |
| Kinase: | TNIK |
| Family: | STE20 |
| Group: | STE |
| Species: | HUMAN |
| Quality Score: | 6.8 |
| Missing Residues: | 3 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | out |
| Salt bridge KIII.17 and EαC.24: | No (5Å) |
| ASP rotation (xDFG.81) : | 334° |
| PHE rotation (xDFG.82) : | 304° |
| Activation loop position: | -4.9Å |
| αC-helix position: | 19.9Å |
| G-rich loop angle: | 52.5° |
| G-rich loop distance: | 15.8Å |
| G-rich loop rotation: | 59.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | ELVGNGTYGQVYKAAIKVMEIKQEINMLKKYSRNIATYYGAWLVMEFCGAGSVTDLIKNHLHQHKVIHRDIKGQNVLLLVDFGVS |
| Structure: | ELVGNG__GQVYKAAIKVMEIKQEINMLKKYSRNIATYYGAWLVMEFCGAGSVTDLIKNHLHQHKVIHRDIKGQNVLLLVDFGV_ |
Modified residues
No modified residues identified.