5D7V - chain C (model A) | Protein tyrosine kinase 6
Structure information
PDB: | 5D7V |
PubMed: | 27480927 |
Release date: | 2016-08-17 |
Resolution: | 2.33 Å |
Kinase: | PTK6 (BRK) |
Family: | Src |
Group: | TK |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (16.7Å) |
ASP rotation (xDFG.81) : | 330° |
PHE rotation (xDFG.82) : | 317° |
Activation loop position: | -5Å |
αC-helix position: | 21.8Å |
G-rich loop angle: | 49.4° |
G-rich loop distance: | 15.3Å |
G-rich loop rotation: | 64.8° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I8
H-bond protein
Binding pocket sequence
Uniprot | RKLGSGYFGEVFEVAIKVIMLQSEIQAMKKLRKHILALYAVYIITELMAKGSLLELLRDYLESQNYIHRDLAARNILVVGDFGLA |
Structure: | RKLGSGYFGEVFEVAIKVIMLQSEIQAMKKLRKHILALYAVYIITELMAKGSLLELLRDYLESQNYIHRDLAARNILVVGDFGLA |
Modified residues
No modified residues identified.