4RLO - chain A | Ribosomal protein S6 kinase B1
Structure information
PDB: | 4RLO |
PubMed: | 25356520 |
Release date: | 2015-01-21 |
Resolution: | 2.53 Å |
Kinase: | RPS6KB1 (p70S6K) |
Family: | RSK |
Group: | AGC |
Species: | HUMAN |
Quality Score: | 7.5 |
Missing Residues: | 3 |
Missing Atoms: | 13 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.3Å) |
ASP rotation (xDFG.81) : | 6° |
PHE rotation (xDFG.82) : | 1° |
Activation loop position: | -2.9Å |
αC-helix position: | 18.2Å |
G-rich loop angle: | 50.5° |
G-rich loop distance: | 15.7Å |
G-rich loop rotation: | 59.1° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | RVLGKGGYGKVFQFAMKVLHTKAERNILEEVKPFIVDLIYAYLILEYLSGGELFMQLERHLHQKGIIYRDLKPENIMLLTDFGLC |
Structure: | RVLGKGGYGKVFQFAMKVL___AERNILEEVKPFIVDLIYAYLILEYLSGGELFMQLERHLHQKGIIYRDLKPENIMLLTDFGLC |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: 3T3
Ligand Name: [(amino-kappaN)methanethiolato](3-fluoro-9-hydroxypyrido[2,3-a]pyrrolo[3,4-c]carbazole-5,7(6H,12H)-dionato-kappa~2~N,N')(1,4,7-trithionane-kappa~3~S~1~,S~4~,S~7~)ruthenium
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 R 95 | 2 V 96 | 3 L 97 | 4 G 98 | 5 K 99 | 6 G 100 | 7 G 101 | 8 Y 102 | 9 G 103 | 10 K 104 | 11 V 105 | 12 F 106 | 13 Q 107 | 14 F 120 | 15 A 121 | 16 M 122 | 17 K 123 | 18 V 124 | 19 L 125 | 20 _ _ |
■ | ■ | ■ | ■▲ | ■ | ■ | ■ | ■ | ■ | |||||||||||
αC | b.l | IV | |||||||||||||||||
21 _ _ | 22 _ _ | 23 A 142 | 24 E 143 | 25 R 144 | 26 N 145 | 27 I 146 | 28 L 147 | 29 E 148 | 30 E 149 | 31 V 150 | 32 K 151 | 33 P 153 | 34 F 154 | 35 I 155 | 36 V 156 | 37 D 157 | 38 L 158 | 39 I 159 | 40 Y 160 |
■ | |||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 A 161 | 42 Y 169 | 43 L 170 | 44 I 171 | 45 L 172 | 46 E 173 | 47 Y 174 | 48 L 175 | 49 S 176 | 50 G 177 | 51 G 178 | 52 E 179 | 53 L 180 | 54 F 181 | 55 M 182 | 56 Q 183 | 57 L 184 | 58 E 185 | 59 R 186 | 60 H 208 |
■ | ▲ | ■ | ■▲ | ■ | |||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 209 | 62 H 210 | 63 Q 211 | 64 K 212 | 65 G 213 | 66 I 214 | 67 I 215 | 68 Y 216 | 69 R 217 | 70 D 218 | 71 L 219 | 72 K 220 | 73 P 221 | 74 E 222 | 75 N 223 | 76 I 224 | 77 M 225 | 78 L 226 | 79 L 234 | 80 T 235 |
■ | ■ | ■ | ■ | ||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 236 | 82 F 237 | 83 G 238 | 84 L 239 | 85 C 240 | |||||||||||||||
■ |
Binding affinities
Ligand not found in ChEMBL.