4NFM - chain A | Tau tubulin kinase 1
Structure information
| PDB: | 4NFM |
| PubMed: | 24637750 |
| Release date: | 2014-02-05 |
| Resolution: | 2.12 Å |
| Kinase: | TTBK1 |
| Family: | TTBK |
| Group: | CK1 |
| Species: | HUMAN |
| Quality Score: | 9 |
| Missing Residues: | 0 |
| Missing Atoms: | 10 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | No |
| ASP rotation (xDFG.81) : | 354° |
| PHE rotation (xDFG.82) : | 354° |
| Activation loop position: | -3.8Å |
| αC-helix position: | 17.4Å |
| G-rich loop angle: | 59.8° |
| G-rich loop distance: | 18.7Å |
| G-rich loop rotation: | 25.8° |
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I4
H-bond protein
Binding pocket sequence
| Uniprot | KKIGGGGFGEIYEVALKVEVLKMEVAVLKKLQDHVCRFIGCYVVMQLQG-RNLADLRRSAIHSVGFLHRDIKPSNFAMMLDFGLA |
| Structure: | KKIGGGGFGEIYEVALKVEVLKMEVAVLKKLQDHVCRFIGCYVVMQLQG_RNLADLRRSAIHSVGFLHRDIKPSNFAMMLDFGLA |
Modified residues
No modified residues identified.